KEGG   Apis mellifera (honey bee): 552458
Entry
552458            CDS       T01057                                 
Name
(RefSeq) DNA-directed RNA polymerase II subunit RPB3
  KO
K03011  DNA-directed RNA polymerase II subunit RPB3
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    552458
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ame03021]
    552458
   03400 DNA repair and recombination proteins [BR:ame03400]
    552458
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     552458
DNA repair and recombination proteins [BR:ame03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      552458
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 552458
NCBI-ProteinID: XP_624836
BEEBASE: GB50996
UniProt: A0A7M7R9A6
Position
LG10:complement(8813156..8814477)
AA seq 276 aa
MPYANQPSVHISDLTEENVKFQVEDTELSVANSMRRVFIAETPTMAIDWIQLEANSTVLS
DEFLAHRIGMIPLISDDVVDRIQYTRDCQCMDFCPECSVEFTLDVKCTEDQTRHVTTADF
KSSDPRVLPVTSRHREDDASEYGETDEILIVKLRKGQELKLRAYAKKGFGKEHAKWNPTA
GVSFEYDPDNAMRHTLFPKPDEWPKSEYSELEEDQYEAPFNWEAKPNKYYFNVESSGALK
PENIVMMGIAALKNKLSNLQTQLSHEVQSDALSIHH
NT seq 831 nt   +upstreamnt  +downstreamnt
atgccttatgctaatcaaccatcagttcatatttctgatttgactgaagaaaatgtaaaa
ttccaagtagaagacacagaattaagtgtagcaaatagtatgagacgtgtctttattgct
gaaacacctactatggctattgattggatacaattagaagctaattcaactgtcttaagt
gatgaatttttagcacatagaattggaatgataccattaataagtgatgatgttgttgat
agaatacaatatacaagagattgtcagtgtatggatttttgtccagaatgtagtgtagaa
tttacacttgatgtcaaatgtacagaagatcaaacacgacatgtaactactgcagatttt
aaatctagtgatccaagagtacttcctgttacatctagacatagagaagatgatgcaagc
gaatatggagaaacagatgaaatattaattgtaaaattaagaaaaggtcaagaattaaaa
ttgagagcatatgcaaagaaaggttttggaaaagaacatgcaaaatggaatcccactgct
ggtgtaagctttgaatatgatcctgacaatgctatgagacatacattatttccaaaacct
gatgagtggccaaaatcggaatatagtgaattagaagaagatcaatatgaagcaccattt
aattgggaggctaaaccaaataaatattattttaatgtagaaagtagtggagctttaaaa
cctgaaaatatagtaatgatgggcattgcagcattgaaaaataaattatcaaatttacaa
acacaattaagtcatgaagttcaaagtgatgcattgagtattcatcattaa

DBGET integrated database retrieval system