KEGG   Apis mellifera (honey bee): 552517
Entry
552517            CDS       T01057                                 
Name
(RefSeq) 60S ribosomal protein L13
  KO
K02873  large subunit ribosomal protein L13e
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    552517
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ame03011]
    552517
Ribosome [BR:ame03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    552517
  Archaea
    552517
SSDB
Motif
Pfam: Ribosomal_L13e
Other DBs
NCBI-GeneID: 552517
NCBI-ProteinID: XP_624896
BEEBASE: GB54192
UniProt: A0A7M7RBV3 A0A8B9B6T4
Position
LG14:complement(6846801..6848371)
AA seq 219 aa
MGKRNNMIPNGHFHKDWQRFVKTWFNQPARKYRRKQNRVKKARTVAPRPVKLLRPVVHCP
TFRYHTKVRAGKGFTLEELKASGLNKRFARTIGIAVDPRRRNKSVESLQTNAQRLKEYKS
KLILFPLNEKKPKKGDASEEEMKLATQVKGEIMPVRHQAPAKAKARVISEEERKFSAYVT
LRKARADARLVGIRAKRVKDAAENPDDVTKVGKDKKAKK
NT seq 660 nt   +upstreamnt  +downstreamnt
atgggtaaaagaaataatatgattcctaatggacattttcataaagattggcagagattt
gtgaaaacatggtttaatcaacctgccagaaaatatcgtcgtaaacaaaatcgtgtaaaa
aaagcccgtactgtcgcaccaagacctgtaaaacttttaagacctgttgttcattgtcca
acatttcgttatcatacaaaagttagggcaggtaaaggttttacattagaagaattaaaa
gcaagtggtttaaataaaagatttgctaggactattggaattgcagtagatcctagaaga
cgtaacaaatcagttgaatctttgcaaacaaatgctcaaagattaaaagaatataaatca
aaattgattctcttcccattaaatgaaaagaaacctaaaaagggtgatgctagtgaggag
gagatgaaacttgctactcaagttaaaggagaaatcatgccagtaagacaccaagcacca
gctaaagctaaagcacgtgtgatttctgaagaagaaagaaaattctctgcatatgtaact
ctccgtaaagctagagctgatgctagattagtaggaattcgtgcgaaacgtgtaaaagat
gcagcagaaaatccagatgatgttaccaaagttggtaaagataaaaaggctaaaaaataa

DBGET integrated database retrieval system