KEGG   Apis mellifera (honey bee): 552523
Entry
552523            CDS       T01057                                 
Name
(RefSeq) uncharacterized protein LOC552523 isoform X1
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00260  Glycine, serine and threonine metabolism
ame00290  Valine, leucine and isoleucine biosynthesis
ame01100  Metabolic pathways
ame01200  Carbon metabolism
ame01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    552523
   00290 Valine, leucine and isoleucine biosynthesis
    552523
Enzymes [BR:ame01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     552523
SSDB
Motif
Pfam: PALP ACT ACT_6
Other DBs
NCBI-GeneID: 552523
NCBI-ProteinID: XP_624902
BEEBASE: GB44710
UniProt: A0A7M7TFX0
Position
LG5:complement(9283687..9289087)
AA seq 464 aa
MRNLNQNGQEFDLIAESGSNDFDSSATTIRQEENDEDDLNDPYCVEDNPQRITFEDVTSA
AFKIKCGIINTPCVKSRLSDTIGVDLYLKKDFLQVTGSFKERGARYALVMLSDEQKKIGV
ISASLGNHAGALCYHGYKLGIPVTVVMPVIAPIMKIVACRQYGANVIVDGLDMEEARRIA
LRRAKEKGLTYINGYDYPDVIAGQGTLGLEIVEQVSNIDAVVVPIGGGGLIAGVALAVKN
LHPNVTIIGVESEKCPSFYKARKADRPTYTRIDSTLADGLAVPVVGYNAFATANPLIDKL
VVVKEEWIAIAILKLVENEKCIVEGAGATGLAAILAGQLEELKGKRVVLPLSGGNIDTTI
LGRCLDRGLAAEGRLLKFTVTVSDRPGGIAELCRMLASIGVSIKDIMHERAWIMSDIFSV
DVKVVCETRNREHAEQLKNMLYQKYQKVVFGTSDVATLNLPASV
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaggaatttgaatcagaacggtcaggagttcgatctgatcgccgagagcgggagcaac
gatttcgactcgtccgcaacaacgatccgtcaagaagagaacgacgaggacgatctgaac
gatccgtactgcgtcgaggataatccccagaggatcactttcgaggacgtcacgtcggcc
gctttcaagatcaaatgcgggatcatcaacacgccatgcgtgaaatctcggctgtcggac
acgatcggcgtagatctttacctgaagaaggatttcctccaagtaaccggaagcttcaag
gagcgcggggcgaggtacgccctggtgatgctgtccgacgagcagaagaagatcggcgtg
atctcggcctcgttgggcaaccacgcaggcgccctttgttatcatgggtacaagcttggc
atacccgtgacagtggtgatgcccgtgatcgcgcctatcatgaagatcgtcgcttgtcgc
cagtacggcgccaacgtgatcgtcgatggcctcgacatggaggaggcgaggcgtatcgcg
cttagacgggccaaggagaaagggctgacgtatataaacggatacgattatccggacgtt
atagcggggcaagggacgctgggcctggagatcgtggagcaagtttccaacatagacgct
gtggtcgttccgataggaggcggcggtttgatcgcgggcgtagctctcgcggtgaagaat
cttcatccgaacgtaacgattatcggcgtcgagtcggagaagtgtcccagtttctacaaa
gcacgaaaggcggatcgaccgacgtacactcgtatagattcgacattggccgatggcctg
gccgtgccagtggtcggatacaacgctttcgcgaccgcgaatccgttgatcgacaaattg
gtggtggtgaaggaggaatggatcgcgatcgcgatcctgaaactggtcgagaacgagaag
tgtatcgtggagggtgcaggcgccactggattggccgccatcttggccggccaattggaa
gagctgaaaggaaaaagggtggtgctgcctttgtcgggcgggaacatcgacacgacgatc
ctcggcaggtgtttggaccgcggactggcggcggaaggcaggcttttgaagttcacagtg
acggtatccgatcgaccgggcggaatcgcggagctttgccgaatgctggcgagcatcggt
gtctcgataaaggacatcatgcacgagcgggcttggatcatgtcggacatcttcagcgtg
gacgtgaaagtggtctgcgagaccaggaatcgggaacacgcggaacaattgaagaacatg
ctgtatcagaaatatcagaaggttgtgttcgggaccagcgacgtggccacactgaatttg
cccgcgagcgtgtaa

DBGET integrated database retrieval system