KEGG   Apis mellifera (honey bee): 552639
Entry
552639            CDS       T01057                                 
Name
(RefSeq) acylphosphatase-1
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00620  Pyruvate metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    552639
Enzymes [BR:ame01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     552639
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 552639
NCBI-ProteinID: XP_625017
BEEBASE: GB52632
UniProt: A0A8B9B2Q1 A0A7M7R927
Position
LG10:complement(8132565..8133613)
AA seq 96 aa
MVQLIGVDFEVFGRVQGVFFRKYTQKHGNELGLKGWCMNTDKGTVIGRLEGEKNKIEEMK
NWLRYTGSPQSAIDKAEFRNEKEISKISFNNFEIKK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggtacaattaatcggtgttgacttcgaagtatttggaagagtacaaggtgtattcttt
agaaaatatactcaaaaacatggcaacgagttaggtttaaaaggttggtgtatgaatact
gataaagggacagttataggtcgtctcgaaggagaaaaaaataaaatagaggagatgaaa
aattggttacgatatacaggaagtccacaatcagctatagataaagcggaatttcgaaat
gagaaagaaataagtaaaatctcgtttaataattttgaaattaaaaaatag

DBGET integrated database retrieval system