KEGG   Apis mellifera (honey bee): 552662
Entry
552662            CDS       T01057                                 
Name
(RefSeq) non-canonical poly(A) RNA polymerase PAPD5-like
  KO
K03514  non-canonical poly(A) RNA polymerase PAPD5/7 [EC:2.7.7.19]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    552662
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ame03019]
    552662
   03016 Transfer RNA biogenesis [BR:ame03016]
    552662
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     552662
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     552662
Transfer RNA biogenesis [BR:ame03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    552662
SSDB
Motif
Pfam: PAP_assoc NTP_transf_2 Polbeta TUTase
Other DBs
NCBI-GeneID: 552662
NCBI-ProteinID: XP_016772964
BEEBASE: GB42920
UniProt: A0A7M7IKZ6
Position
LG6:complement(4820988..4826990)
AA seq 573 aa
MDPTIGWYQPEQFGPAKDLWLHIWEAEKGLDILTLKNDSSSNVMGVKLQQDFISLDSLNS
RTGDRMQHNTCNSYYNPSRRKGDNRASTYGMNYNYDALVGEYGGCPWRVPNKHYSKGVIG
LHEEIEDFFAYMCPSNEEHSLRIRVVKRIEQVIYDLWPDSKVEVFGSFRTGLYLPTSDID
LVVIGMWTNLPLRTLERALLDQNIAEPSSIKVLDKASVPIVKLTDKETEIKVDISFNMNN
GVKSAELINSFKKRFPVLEKLVMVLKQFLLQRDLNEVFTGGISSYSLILMTISFLQLHPR
QNAYCSNANLGVLLIEFLELYGRKFNYVKTGIRVKDGGTYISKEEVQRDMIDGHRPSLLC
IEDPLTPGNDIGRSSYGALYVKDAFDWAYYVLSQAVSPLNILVNDANKVSILGRIIRVTD
EVIEYRKWIKETFPLPLSEVDSLSSSTGSDASTLSAPASDTDSECSRGNSPNTSGKGEDR
NKERHVYNNQHTHHHSQWKKPFKATTHGNHHHNSRGNYHHRGINNNNISGQSKAKHSLHS
NGNNNNSHSPSSRSQTVKRKKHCITPRTGDCVR
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggatccgactatcggttggtatcaaccggagcagttcggccctgctaaggatttgtgg
ttacacatttgggaagctgaaaaaggcttggatattttaacgttgaaaaacgattcgtct
tcgaatgtaatgggtgtgaagcttcaacaagacttcatatctttagattctctcaattct
cgtacgggagatcgcatgcaacataatacttgtaatagctattataatccatcgcgtagg
aaaggtgataatcgtgctagtacctacggcatgaactacaattatgatgccttagttggc
gaatacggtggttgtccatggcgagtacccaataaacattattcaaaaggtgttattgga
ttacatgaagaaattgaagatttttttgcttatatgtgtccctctaatgaagaacatagt
ttacgaatacgtgttgtcaaaaggatagaacaagtaatatatgatctctggccagattct
aaggttgaagtatttggcagctttcgtactggtttatatttacctacaagtgatatagat
ttagtggtaataggaatgtggacaaatcttccattacgcactttggaacgtgctttattg
gatcaaaatattgctgaaccatcttctattaaggttttagataaagctagtgttccaatt
gtcaagctgactgataaagaaactgaaattaaagtagatatcagttttaatatgaataat
ggtgttaaatctgcagaattgataaattcttttaaaaagaggtttccagtactagaaaag
ctagttatggtattaaagcaattcttgttacaaagagacctgaatgaagtgtttactggt
ggaatctcatcatatagtttaatacttatgactatcagttttttacagttacatcctaga
caaaatgcttattgttcaaatgctaatcttggggtgctgttaatagaatttttggaatta
tatggtaggaaatttaattatgttaaaacaggaattcgtgtaaaagatggtggtacttac
atatcaaaggaagaggttcaaagggatatgatagatggccatcgaccttctttattatgc
atagaagatccacttacaccaggaaatgatattggtcgtagtagttatggtgctctatat
gtaaaagatgcatttgattgggcttactatgtcctttcacaagcagttagtcctttaaat
atattagttaacgatgcaaataaagtaagtatactaggaagaataattcgagtgacagat
gaagtaatagaataccgcaaatggattaaagaaacattcccactacctttgagtgaagta
gattcattgtcaagttctactggttctgatgcttcaacattatctgctccagctagtgat
acagattctgaatgtagtcgtggaaattctcctaacactagtggaaaaggagaagataga
aataaagaaagacatgtatataataatcagcatactcatcatcattcacaatggaaaaaa
ccatttaaagcaactactcatggtaatcaccatcataattccagaggaaattatcatcat
cgtggaataaataataataatataagtggacaaagtaaagcaaaacattctcttcatagt
aatggaaataataataatagccatagtccaagttcaaggtcacaaactgttaaacgaaaa
aaacattgcattacacctcgtactggagattgtgtacggtga

DBGET integrated database retrieval system