KEGG   Apis mellifera (honey bee): 552774
Entry
552774            CDS       T01057                                 

Definition
(RefSeq) 60S ribosomal protein L28
  KO
K02903  large subunit ribosomal protein L28e
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    552774
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ame03011]
    552774
Ribosome [BR:ame03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    552774
SSDB
Motif
Pfam: Ribosomal_L28e
Other DBs
NCBI-GeneID: 552774
NCBI-ProteinID: XP_016773031
BEEBASE: GB52512
UniProt: A0A088ALQ3
AA seq 138 aa
MSSHLNWMIIRNNNAFLLKKRNINKPFSTESNNLTNLSSYRYSGLIHRKSVGIVDTSDKK
GFTIVYKKAKAMNKPAKATVRCTMKAGARRSLYKLKRLLTKNKYRIDLTKAALRRASAVL
RSQKPLPAKKTRTTKKAD
NT seq 417 nt   +upstreamnt  +downstreamnt
atgtcgtctcatttaaattggatgattatccgtaataataatgcgttcctcttaaaaaaa
cgcaatattaacaaaccattttcaacggaatctaacaatttgaccaatttgagtagctat
cgttattctggtttgattcatagaaaaagtgttggtattgttgatacatctgataaaaag
ggatttacaatagtttataaaaaagctaaagctatgaataaacctgcaaaagctacagtt
cgatgtacaatgaaagctggagctcgtcgatccttatataaattaaaaagattgcttaca
aaaaataaatatcgtatagatctcactaaggctgcattacgtcgagctagtgctgtgttg
cgctctcaaaagcctttacctgctaagaagactcgaacaacaaaaaaggctgattaa

DBGET integrated database retrieval system