KEGG   Apis mellifera (honey bee): 724429
Entry
724429            CDS       T01057                                 
Name
(RefSeq) synaptic vesicle glycoprotein 2C-like
  KO
K06258  MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    724429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ame02000]
    724429
Transporters [BR:ame02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    724429
SSDB
Motif
Pfam: MFS_1 Sugar_tr TRI12
Other DBs
NCBI-GeneID: 724429
NCBI-ProteinID: XP_016767355
BEEBASE: GB50473
UniProt: A0A8B7KIL0
Position
LG4:complement(7961856..7970291)
AA seq 525 aa
MVNSINSLSFSGVENNGGKEGAADFEKAIKMCGYGRFHYGFLLLCGAMFLCVGCQNGINA
YILPSAECDLNLTSEQKGLLNVSFLLGGVISSLFWGIFADAYGRRYILLLTLLSDSILSI
GGSFSQSFKVLLIFRGLNGFFIGAPGSLVYTYLGEFHAQKQRAKAICYVGFFWTLSWLIL
PGLAWIIIPLPMSFQFNGILYNSWRLFLAVIGIPTLMVAFVASRYPESPKFLVSQGKTEE
ALTILRKIYAINSGCDEDEYPIKILLSDDTLNINNRKRSFSASRILMELLKNIWQQARSL
ASPPLLKYALLCWTIYFANMFGYYGFGLWLPELFNRFENYHKLFPEQSVSVCKLIHETDQ
QTVKNILINSTDVDNCSPNMDQMVFINSLTINAFCLLGNIMSGFLANRVGRRTIPVTTML
LAGIFGFAIYFVQSSLQILMVSCMFSLMIGTANFVISSIVVDIFPTHVGAVAICMMTCFG
RIGAIASNLTFGMLLDISCEVPIFLVGSIVIFGGLLALLLSKKRS
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggttaacagtattaattctttgtcgttttctggcgttgagaataatggaggcaaagaa
ggagctgcagattttgaaaaagcaatcaaaatgtgcgggtacggaagatttcactatggc
tttctacttctctgcggagcaatgttcctctgtgttggttgccaaaacggtataaacgca
tatatcttgccatccgcagaatgtgatcttaatttgacttctgaacaaaaaggtcttctg
aacgtctcctttctcttaggaggagttataagttcccttttctggggaatattcgcagat
gcctacggaaggagatatattcttctccttactttattaagcgacagtattttatcaatt
ggaggaagtttctctcaaagttttaaagtgctgttaattttcagaggtctcaatggattt
tttatcggtgctcctggatctctagtctatacgtatcttggcgagtttcatgcgcaaaaa
caaagagcaaaagctatttgttacgttggattcttttggactctatcatggttaatatta
cccggtttggcctggatcattataccgctgccaatgtcctttcaattcaacggaatatta
tataattcttggcgacttttcttggccgttattggaataccaacgctaatggtagctttt
gtcgcaagcagatatcccgagagcccaaaatttttggtctcccagggaaaaacggaggaa
gcattgacgattttacgaaaaatctacgcgataaacagtggttgtgacgaggatgaatat
ccgataaaaatcttattatctgacgatacattgaatattaataatcgtaaaagatcattc
tccgcgtctagaatattaatggaattattaaaaaatatttggcaacaagcacgttcgctt
gcatcaccaccacttttgaaatatgcgcttctctgttggaccatttacttcgcaaatatg
ttcggttattatggattcggtttatggttgccagaattgtttaatcgtttcgaaaattat
cataaattatttccggaacaaagtgtaagcgtgtgtaaattgatccacgagaccgatcaa
caaactgtgaaaaacattttaattaattcaaccgacgtggataattgttctcctaatatg
gatcaaatggtttttatcaattcattgacgattaacgcattttgcttattgggcaacatc
atgtccggttttttggcaaaccgtgttggtcggcgaacgattccagtaacaaccatgttg
ttggctggtattttcggttttgccatatattttgtccaatcttccctgcaaattctcatg
gtgagctgcatgttctcgttgatgataggcacagcgaatttcgtcattagcagtatagta
gttgacatatttccaacgcatgtaggcgccgttgcgatttgtatgatgacctgtttcgga
agaatcggcgccatagctagtaatttaacttttggaatgttgctcgatatcagttgcgag
gttccaatctttttagtcggtagcatagtgatctttggaggattattagcactgcttctg
tcgaagaaaagaagttga

DBGET integrated database retrieval system