KEGG   Apis mellifera (honey bee): 725348
Entry
725348            CDS       T01057                                 
Name
(RefSeq) DNA mismatch repair protein Msh2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    725348
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ame03400]
    725348
DNA repair and recombination proteins [BR:ame03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     725348
SSDB
Motif
Pfam: MutS_V MutS_III MutS_IV MutS_II MutS_I AAA_27 RSS_P20
Other DBs
NCBI-GeneID: 725348
NCBI-ProteinID: XP_006571175
BEEBASE: GB40028
UniProt: A0A8B6ZDC2
Position
LG1:complement(18576049..18586776)
AA seq 921 aa
MAVQPNQQFNMDPSSQQSFVRFFKNLPEKLNTTVRFFNRSDYYTLHGNDALFAAQEIFKT
TSVCKMIGADPYKTEGVILNKNHFESFIRDLLLVKQYRVEVYINQGTAKNQNWILEYKGS
PGNLTQFEDILFGNNDIAVSVRVIAVKLGMEGKFRIVGLSCVDTTATLFSVCEFQDNESF
SNLESLIVTLAPKECLLIQGEGSYEFQTLKQLIERNNVMITTRKKNEFSSESVIQDLNTL
IRFKKGQQQNVQSLPEVNLTFAMSATSALIKYLDLTSDEGNLNQFSIDQIKQSRYLKLDS
AAIKALNIEPRIDTSCVLNGNAPTSILNLLDKCRTPQGHRLLAQWIRQPLKDLSLIKERH
DIVEVLVNDNELRSNLNEDHLRRIPDLQVLAKKLARKKATLQDCYKIYTCMSHLPILLEQ
FLKINIIALKTMFTDPLSEFIKDMDKFQQMVEQTIDLDSAEKGDFLVRPEFDDELKELKC
TMDEIEIKLQAQLNKVADDLSIEAGKILKLESNQQFGYYFRVTLKEEKVLRNKKQYIILD
SNKSGVRFRSNKLNDLNDEYIGIRDKYIMEQKKVVAEIIEIAAGYSNTIKAIGNVLASID
VLTAFASAAICANKPYVRPEMLPSEKGEFNLIQVRHPCLEVQEGVDYIANDINFKRGECH
FCIITGPNMGGKSTYIRSAGVTALMAHIGSFVPCDQARISLLDCILARVGADDCQLKGLS
TFMMEMIETAAILKTATCNSLVLIDELGRGTSTYEGCGIAWSIAEYLAKEIKCYCLFATH
FHEITKLEEEISTVKNQHVTALVDNNKLTLLYKIKPGICDQSFGIHVAKMANFPQDVIEF
AKRKQAELEDYQDSLFEGSDNPQKKRKIIQEAEIFIAEFIDKCKNLDLSLSDAELKDKIL
TFKEEVLSHKNPYIQMLLTAS
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggctgtccaaccaaatcaacaatttaatatggatccatcaagtcaacaaagttttgtt
aggttttttaaaaatctaccagaaaaactgaataccacagtacgtttttttaatagatca
gattattatacattacatggtaatgatgctttatttgctgcacaagaaatttttaaaact
acatctgtttgtaaaatgataggtgcagatccatataaaactgaaggagttattcttaat
aaaaatcattttgaatcttttatacgtgatctattgttagtaaaacaatacagagtagaa
gtttatattaatcaaggaactgcaaaaaatcaaaattggatattagaatataaaggatct
cctggtaatttaacacagtttgaggatatattgtttggcaataatgatattgctgttagt
gttcgtgttatagcagtgaaattaggaatggaaggaaaatttagaattgtaggtttaagt
tgtgtagatactacggcaactttattttctgtttgtgaatttcaagataatgaatcattt
tctaatttggaatcattaattgtcacacttgctcctaaagaatgtttattaattcaaggc
gaaggcagctatgaatttcaaactttaaaacaactaatagaacgaaataatgtgatgatt
actacaagaaaaaaaaatgaattctctagtgaatcagttatacaagatttaaatactttg
ataagattcaagaaaggtcaacaacaaaatgtacaatctttacctgaagtcaatttaact
tttgctatgtcagctacttctgctcttattaaatatttagatttaacatcagatgaagga
aatttgaatcagtttagcatagatcaaataaagcaatcacgttatttgaaattagattca
gctgctataaaagcacttaatattgaaccacgtattgatacttcttgtgttttaaatgga
aatgcacctacaagtattttgaatctcttagataaatgtagaactccacaaggacataga
ctccttgcacaatggattagacaacctttaaaagatttatcacttataaaagaaagacat
gatattgttgaagtattagtaaatgacaatgaattacgatctaatcttaatgaagatcat
ttaagacgcataccagatttacaagtacttgcaaaaaaattggccaggaaaaaagcaaca
ctacaagattgctataagatttatacatgtatgtcacatttacctatattattagaacaa
tttcttaaaataaatataatagctttaaaaacaatgtttactgatcctttaagtgaattt
attaaagatatggataaatttcaacaaatggttgaacaaacaattgatttagattctgct
gaaaaaggagattttttagtacgacctgaatttgatgatgaattaaaagaattaaaatgt
actatggatgaaatagaaataaaattgcaagcacaattgaataaagttgctgatgatctt
tcaatcgaagctggaaaaatactaaaactagaatcaaatcaacaatttggatattatttc
cgtgtaacattgaaggaagaaaaggtattaagaaataaaaaacaatatattattttagat
tctaataaaagtggtgtacgatttcgaagtaataaattaaatgatttaaatgatgaatac
attggtattagagataaatatataatggaacaaaaaaaagttgttgcggaaataattgaa
attgcagctggttatagtaatacaataaaagctattggaaatgtattagcatcaattgat
gtacttactgcttttgcttctgctgctatatgtgctaataaaccatatgtgcgtcctgaa
atgctccctagtgaaaaaggagaatttaatcttattcaagttcgacatccatgtttagaa
gttcaagaaggagtagattatatagctaatgatatcaattttaaaagaggagaatgtcat
ttttgtattattactggtccaaatatgggaggtaaaagtacatatataagatctgctggt
gttactgctctcatggcacatattggaagttttgttccttgtgatcaagcaagaatatca
ttattagactgtatattagctcgtgtaggagctgatgattgtcaattgaaaggactttct
acatttatgatggaaatgatagaaactgctgctatattaaagacagcaacatgcaattca
ttagtgttgattgatgaattaggcagaggaacttctacttatgaaggttgcggtatagca
tggtcaatcgccgaatatttagcaaaagaaattaaatgttattgtctttttgcaacacat
tttcatgaaataactaagttagaagaagaaatatctactgttaaaaatcaacatgttaca
gctcttgtagataataataaattaactttattatataaaataaaaccaggaatatgtgat
caaagttttggcatacacgtcgctaaaatggctaatttcccacaagatgttattgagttt
gctaagcgtaaacaagcagaacttgaagattatcaagattcactttttgaaggatctgat
aatccacagaagaaaagaaaaatcatccaagaagccgaaatttttattgcagaatttatt
gataaatgtaagaatttagatctatcattatctgatgcagagttaaaggataagatttta
acatttaaagaagaagttttatctcacaaaaatccctatatacaaatgcttcttacagct
tcataa

DBGET integrated database retrieval system