KEGG   Apis mellifera (honey bee): 725396
Entry
725396            CDS       T01057                                 

Name
(RefSeq) THO complex subunit 4
  KO
K12881  THO complex subunit 4
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03013  Nucleocytoplasmic transport
ame03015  mRNA surveillance pathway
ame03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    725396
  09122 Translation
   03013 Nucleocytoplasmic transport
    725396
   03015 mRNA surveillance pathway
    725396
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ame03019]
    725396
   03041 Spliceosome [BR:ame03041]
    725396
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     725396
    TREX complex
     725396
Spliceosome [BR:ame03041]
 Complex C
  Other components
   EJC/TREX
    725396
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    725396
SSDB
Motif
Pfam: RRM_1 FoP_duplication Btz RRM_occluded
Other DBs
NCBI-GeneID: 725396
NCBI-ProteinID: XP_001121250
BEEBASE: GB50832
UniProt: A0A7M7LKK4
Position
LG2:6609711..6612128
AA seq 249 aa
MKMVDKIDMSLDDIIKQNKGSRPRGGTGRRGRGAGNSPRRGARRTQRVGGVMRGRNRGGI
TRNSLPYTRGDVNSAWKHDMFDGVKKVGRSAIGSAGTTKLLVSNLDFGVSDSDIQELFSE
FGPLKSAAVHYDRSGRSLGSADVIFERRADAIKAMKQYNGVPLDGREMNIQVATSEIPVT
SIRGGPRLTSSSNYTQRPQSRFRGNRGAGSIRGRGTGRRGGRGGSRQATKTPTAEELDAE
LEAYVKEVK
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaagatggttgataaaatagacatgagtcttgatgatattatcaagcaaaataaagga
agtagaccacgtggcggcactggcagacggggaagaggtgccggtaattcacctcgtaga
ggagcacgcagaacgcaaagagttggtggcgtcatgcggggacgcaatcgtggtggcatt
acaagaaattctcttccatatacaaggggtgatgtaaacagtgcatggaaacacgacatg
tttgatggggtaaaaaaggttggccgaagtgcaataggtagcgcaggaacaaccaagctt
cttgtatcaaatcttgactttggagtatcagattcagatattcaggaattatttagtgaa
tttggccccttaaagtcagcagcagtgcattacgataggtcaggtcgatcattaggctct
gcagatgttatatttgaaagaagagcagatgctattaaagcaatgaaacaatataatggc
gtacccttagatggtcgtgaaatgaacatacaagttgctacctctgaaataccagtcaca
tctatccgtggaggcccgagacttactagcagcagtaattatacacagagacctcagtcc
cgctttaggggtaaccgtggagcaggatccatcagaggtcgtggaactggccgacgtggt
ggcagagggggcagtcgacaagcgacaaaaactcctaccgccgaagaattagatgcagaa
ctggaagcttatgtgaaagaagtaaagtaa

DBGET integrated database retrieval system