KEGG   Apis mellifera (honey bee): 725502
Entry
725502            CDS       T01057                                 

Definition
(RefSeq) homeobox protein ARX
  KO
K09452  homeobox protein aristaless-related
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ame03000]
    725502
Transcription factors [BR:ame03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    725502
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 725502
NCBI-ProteinID: XP_001121339
BEEBASE: GB52781
UniProt: A0A088AMF9
AA seq 250 aa
MDLKEEDESANENGRQLFLVGAPRDPLVSTGAIVASAGAPDEINSAGDLQSTALAGLIGA
QSSSVCFPTKFSYDFSSSPGSEDRQSTGVGKRKQRRYRTTFTNFQLEELERAFQKTHYPD
VFFREELALRIQLTEARVQVWFQNRRAKWRKQEKQCKVTTHLTSHLPPSECQEVQQQQQQ
QQSDHLLLEPPLGSPPPIYLGMEWAGFSPYSNTATASSLVVNSMNKPLESEADDNPLLDP
ELLQLKTPRS
NT seq 753 nt   +upstreamnt  +downstreamnt
atggatttaaaggaagaagacgaaagtgcgaacgaaaatggtagacaactatttttagtg
ggtgcaccgcgtgatcctctagtgtccactggagcgatcgttgcttctgctggagcacca
gatgagatcaactctgcaggagatctacagtcgactgctctagctggtctgataggcgct
caatcttcctcagtttgctttcctacaaaattctcgtatgatttttcatcaagtccggga
agtgaagataggcaatcaactggagtcggtaaaagaaaacagcgcagatatcgtaccacg
ttcacgaactttcaattggaagaattggaaagagcatttcaaaaaacgcattatcctgat
gtattttttagagaagaacttgctctccgtattcaattgacagaagccagagtacaggta
tggtttcaaaatagaagagcaaaatggcgaaaacaagagaaacaatgtaaagtaaccact
cacttgacttcgcatttgccaccttctgaatgccaagaagtacaacagcagcaacagcag
caacaatcagatcatttgttattggaaccaccattaggtagcccaccacccatatatctt
ggcatggaatgggcaggattttcaccatatagtaacacagctactgcatcatctcttgtg
gttaatagtatgaataagccattagaatcagaggcggatgataatcctttgctggatcca
gaattgttgcaactaaaaactccacgttcctaa

DBGET integrated database retrieval system