KEGG   Apis mellifera (honey bee): 725899
Entry
725899            CDS       T01057                                 
Name
(RefSeq) alpha-N-acetylgalactosaminidase
  KO
K01204  alpha-N-acetylgalactosaminidase [EC:3.2.1.49]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ame01100  Metabolic pathways
ame04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    725899
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    725899
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.49  alpha-N-acetylgalactosaminidase
     725899
SSDB
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase_C Melibiase
Other DBs
NCBI-GeneID: 725899
NCBI-ProteinID: XP_006570321
BEEBASE: GB45673
UniProt: A0A7M7H421
Position
LG5:complement(13351039..13356183)
AA seq 439 aa
MLQIIWIWCLIVSVADLTLALENGLVKTPPMGWLAWERFRCNTDCKNDPENCISDRLFRT
MADIVVAEGYAAVGYEYINIDDCWLEKDRSVNGQLVPDRQRFPYGMKNLANYIHSKGLKF
GIYEDFGNYTCAGYPGILGYLETDAHTFASWDVDYVKLDGCYSHPSEMDRGYPEFGFYLN
QTGRAMVYSCSWPVYQIYAGMQPNYTAITEHCNLWRNFDDIQDSWNSLETIIDYYGNNQD
VIVPNAGPGHWNDPDMLIIGNFGLSYEQSKTQMALWAILAAPLLMSVDLRTIRPEYKAIL
QNRKIIAVDQDPLGIQGRRIYKHKGIEIWARPITPVYQNYFSYAVAFMNRRTDGTPSDVS
VTLKELGLQYPGGYNVEDLYEDVNYGVLTPQTKIKVKVNPSGVVILRCDLHLEDIFNTNE
FSQYTPSNQLFKVRQNSFK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgttgcagataatatggatatggtgtttaattgtgtcagtggctgatttgacattggcc
cttgaaaatggtctcgtgaaaacaccaccgatgggctggcttgcctgggaacgattcagg
tgtaatacagactgcaaaaatgatcctgaaaattgtatcagtgatcgactctttcgtaca
atggcagatattgttgtagcagaaggctatgctgcagttggatatgaatatatcaatatt
gatgattgttggctggaaaaagatagaagtgttaatggtcaattagtgccagatagacaa
agattcccatatggcatgaaaaatcttgctaattatattcattcaaaaggtcttaaattt
ggaatttatgaagattttggtaactatacatgtgctggttatcctggaatattaggatat
ttagaaactgatgcacatacatttgcatcatgggatgttgattatgtaaaattagatgga
tgttattcccatccttcagagatggatagaggatatcctgaatttggattctacttaaat
caaactggtcgagcaatggtatattcttgtagttggccagtttatcaaatttatgctggc
atgcagccaaattatactgctataacagaacattgtaatttgtggagaaattttgatgat
atacaagattcgtggaatagtttagaaaccattattgattattatggaaataatcaagat
gtgattgtaccaaatgctggtcccggccattggaatgatcctgatatgttgattattgga
aatttcggattaagctatgaacaaagcaaaacacaaatggcattatgggcaattttagct
gcaccattattaatgtctgttgatctacgaacaatcagacctgaatacaaagctatttta
caaaatagaaaaattattgctgtagatcaagatccattaggtatacagggtcgacgaatt
tataaacacaaaggtattgaaatttgggcgagaccaattactcctgtttatcagaattat
ttttcttatgctgtagcgtttatgaacagaagaacagatggtacgccttctgatgtatct
gttacgttaaaagaacttggattacagtatcctggaggatataatgtcgaggatctatat
gaagatgtaaattacggtgttttaacaccacaaacgaaaataaaagttaaagttaatcct
tccggagttgtaatattacgctgcgatttacatttagaggatatttttaatacgaatgaa
ttttcgcaatatacaccgtcgaatcaactatttaaagtgagacagaactcatttaagtaa

DBGET integrated database retrieval system