KEGG   Apis mellifera (honey bee): 725931Help
Entry
725931            CDS       T01057                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00010  Glycolysis / Gluconeogenesis
ame00562  Inositol phosphate metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    725931
   00562 Inositol phosphate metabolism
    725931
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     725931
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     725931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 725931
NCBI-ProteinID: XP_001121719
BEEBASE: GB46930
UniProt: A0A088A6I1
AA seq 442 aa AA seqDB search
MQWLLNIQILLIINAINVIFTFTHNCVLHNKDYRCKLGTKTPYRFISNYNDSPLEYSGCI
SKKIWLLLRHGTRYPGKKYASSMIEKLPKLKKIILDNYKENKTKFTKEEAVLFKEWKISF
SEDNIMKLTEEGENEMIDIGERYQSRFPNLMPEIYNNQTYKFKYTATQRTEESAKNFVIG
LFGRYNSHQVQYPKAEHKDPILRFYKRCERWRSEIDKNPNSRIEKDKFLKSEIYKKMLDD
VSIRIGYQINHENIYLMYLMCGFETAWNKKFESPWCKVFSLHDFKILEFADDLEYYWNDG
YGYKLSYEQACPALRDVFNFFASDEELLVSAYFTHSGTILKLLTLLGVAKDDQHLTHDLF
SLYSDDRAWRTGIIDTFASNIAFILYNCSGISSVLFMHQERPLYLPGCPINIPCSLSTMK
ALYPDQEEECQFEKMCSMKESS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggctattaaatattcaaatacttttaattattaatgcaataaatgtaatattc
acatttacacataattgtgttttgcataataaagattatagatgtaaattaggaacaaag
acaccatatagatttatatcgaattataatgattctcctcttgaatattcaggttgtatt
tcaaaaaaaatatggttgcttttaaggcatggtacaagatatcctggtaaaaaatatgca
tcatctatgattgagaaattgccaaaattaaaaaaaattattctagacaactataaagaa
aacaaaacaaaatttacaaaagaagaagcagttttatttaaagaatggaaaattagtttt
agtgaagataatatcatgaaattaacagaagaaggtgaaaatgaaatgatcgatattgga
gaaagatatcaatccagatttcctaatcttatgccagaaatatataataatcaaacttat
aagtttaaatacactgctactcaacgcacagaagaaagtgctaaaaattttgttattggt
ctatttggaagatacaatagtcatcaagttcagtatccaaaagcagaacataaggatcct
atattaagattttataaacgttgcgaacgttggcgttctgaaattgacaaaaacccaaac
tcgcgtatagaaaaagacaaatttttgaaaagtgaaatttataagaaaatgttagatgat
gtttctatacgtattggttatcaaattaatcacgaaaatatatatttaatgtatttgatg
tgtggatttgaaacagcatggaataaaaaattcgaatcaccatggtgtaaagtattttca
ttgcatgatttcaagatacttgaatttgctgatgatttagaatattattggaatgatgga
tatggatataaattatcttatgagcaagcatgtcctgctttgagagatgtttttaacttt
tttgcatcagatgaagaattgttggtatcggcgtattttacccattcaggcactatttta
aagttgctaactttattaggagttgcaaaagatgatcaacatttaacacacgatttattt
tcattatattctgacgatagagcttggagaactggaattattgatacttttgcatctaat
attgcattcattctatataattgttctggaatttccagtgttctttttatgcatcaggaa
agaccattatatttaccaggatgtcctataaatataccatgttcattgtctactatgaaa
gcactttatcccgaccaagaagaagagtgtcaatttgaaaaaatgtgttcaatgaaggaa
tcatcataa

DBGET integrated database retrieval system