KEGG   Apis mellifera (honey bee): 726117Help
Entry
726117            CDS       T01057                                 

Gene name
Tpi, GB17473
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00010  Glycolysis / Gluconeogenesis
ame00051  Fructose and mannose metabolism
ame00562  Inositol phosphate metabolism
ame01100  Metabolic pathways
ame01200  Carbon metabolism
ame01230  Biosynthesis of amino acids
Module
ame_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ame_M00002  Glycolysis, core module involving three-carbon compounds
ame_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    726117 (Tpi)
   00051 Fructose and mannose metabolism
    726117 (Tpi)
   00562 Inositol phosphate metabolism
    726117 (Tpi)
Enzymes [BR:ame01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     726117 (Tpi)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   726117 (Tpi)
  Exosomal proteins of bladder cancer cells
   726117 (Tpi)
  Exosomal proteins of melanoma cells
   726117 (Tpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM Ribosomal_S24e
Motif
Other DBs
NCBI-GeneID: 726117
NCBI-ProteinID: NP_001090623
UniProt: A4ZXC4
Position
LG16
AA seq 247 aa AA seqDB search
MGRKFFVGGNWKMNGTKSEINDIVGFLKKGPLDSNVEVVVGVPSIYLTYAKNILPNNISI
AGQNTYKVAKGAFTGEISPAMLLDNGIPWVILGHSERRNIFGENDELIAEKVAHALESGL
KVIACIGEKLEEREAGKTDEVVFRQTKAIANKINSWDNVVVAYEPVWAIGTGKTATPQQA
QEVHEKLRNWFSKNVNQTVAETVRIIYGGSVTAGNAKDLAKEKDIDGFLVGGASLKPDFV
QIVNAKQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtaaattttttgttggtggtaattggaaaatgaatggtaccaaaagtgaaata
aatgatattgttggctttttaaaaaaaggtccacttgattcaaatgttgaggttgttgtt
ggtgtaccatctatatatttaacatatgccaagaatatattacccaataatattagtatt
gctggacaaaatacatataaggttgcaaaaggagcatttactggagaaataagtcctgct
atgcttttggacaatggaatcccatgggtaattcttggtcattccgaacgtagaaatatt
tttggtgaaaatgatgaattaatagcagaaaaagtagcccatgctttagaaagtggacta
aaggtaattgcatgtattggagaaaaattagaagaaagagaagctggtaaaacagatgaa
gtagtttttagacagacaaaagctattgcaaataaaatcaattcatgggataatgtagtt
gttgcttatgaaccagtttgggcaattggaacgggtaaaacagccacaccacaacaagct
caagaggttcatgaaaaattaagaaattggttttctaaaaatgttaatcaaactgtcgca
gaaactgttagaattatttatggaggttcagtaacagcaggaaatgcaaaagatttagca
aaagagaaagatattgatggatttttagttggtggagcatctctaaaacctgattttgta
cagatcgttaacgctaagcagtga

DBGET integrated database retrieval system