KEGG   Apis mellifera (honey bee): 726923
Entry
726923            CDS       T01057                                 
Name
(RefSeq) DNA polymerase epsilon subunit 3
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03030  DNA replication
ame03410  Base excision repair
ame03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    726923
   03410 Base excision repair
    726923
   03420 Nucleotide excision repair
    726923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ame03032]
    726923
   03036 Chromosome and associated proteins [BR:ame03036]
    726923
   03400 DNA repair and recombination proteins [BR:ame03400]
    726923
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     726923
DNA replication proteins [BR:ame03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    726923
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    726923
DNA repair and recombination proteins [BR:ame03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      726923
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C RNA_pol_Rpc34 PTS_IIA Importin_rep_6
Other DBs
NCBI-GeneID: 726923
NCBI-ProteinID: XP_001122640
BEEBASE: GB46619
UniProt: A0A8B8H6V8 A0A7M7M124
Position
LG11:complement(408426..414912)
AA seq 129 aa
MAERLEDLNLPNAVVTRIIKEALPEGVTIAKDARTAVAKASSIFILYLTSSANIIAKKGN
RKTISGQDVIQAMNDIEFDEFVDPLQESLENFRKAQKEKKDATSKKKQQKKDEDDIIEEE
DGGREVMVF
NT seq 390 nt   +upstreamnt  +downstreamnt
atggcagaaagattagaagatcttaatttaccaaatgcagttgtaacaagaattataaaa
gaggcattaccagaaggagttacaattgctaaagatgctagaactgcagtagcaaaagca
tcttcaatttttatattatatttaacatcatctgcaaatataattgctaaaaaaggaaat
cgtaaaacaataagtggtcaagatgttattcaagcaatgaatgatatagaatttgatgag
tttgttgatccacttcaagaatcattagaaaattttcgtaaagctcaaaaagaaaagaaa
gatgcaacatctaaaaaaaaacaacagaaaaaggatgaagatgatataatagaagaggaa
gatggtggaagagaagttatggtgttttga

DBGET integrated database retrieval system