KEGG   Apis mellifera (honey bee): 727483
Entry
727483            CDS       T01057                                 

Name
(RefSeq) protein stunted isoform X1
  KO
K02135  F-type H+-transporting ATPase subunit epsilon
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00190  Oxidative phosphorylation
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    727483
SSDB
Motif
Pfam: ATP-synt_Eps
Other DBs
NCBI-GeneID: 727483
NCBI-ProteinID: XP_001123191
BEEBASE: GB49606
UniProt: A0A7M7FZI1
Position
LG4:5505958..5508205
AA seq 58 aa
MSAWRQAGLNYINYSQIAAKLVRQALKSEFRAEALKRDETNIKFTQWKDGKPTKTHKL
NT seq 177 nt   +upstreamnt  +downstreamnt
atgtctgcgtggagacaagcgggattaaattacatcaattattctcaaatagctgctaaa
cttgttagacaagcattaaaatcagagtttcgagcagaagctttgaaacgtgatgaaaca
aatataaaatttactcaatggaaagatggtaaacctactaaaactcataaattataa

DBGET integrated database retrieval system