KEGG   Apis mellifera (honey bee): 727568
Entry
727568            CDS       T01057                                 

Definition
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
  KO
K12668  oligosaccharyltransferase complex subunit epsilon
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00510  N-Glycan biosynthesis
ame00513  Various types of N-glycan biosynthesis
ame01100  Metabolic pathways
ame04141  Protein processing in endoplasmic reticulum
Module
ame_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    727568
   00513 Various types of N-glycan biosynthesis
    727568
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    727568
SSDB
Motif
Pfam: DAD
Other DBs
NCBI-GeneID: 727568
NCBI-ProteinID: XP_001123277
BEEBASE: GB55961
AA seq 111 aa
MTALAVIAKFWQEYTKTTPKKLKIIDAYLLYVFLTGVIQFIYCCLVGTFPFNSFLSGFIS
CVSCFVLGVCLRLQVNPQNKNQFHGISPERGFADFIFAHVILHLVVMNFIG
NT seq 336 nt   +upstreamnt  +downstreamnt
atgactgcattagcagttattgcaaaattttggcaagaatatacgaaaactacaccaaaa
aagcttaaaataatagatgcttatctactttatgtgtttttaacgggtgttatacaattc
atatattgttgtttggtcggcacatttcctttcaatagttttcttagtggatttatttcc
tgtgtgtcatgttttgttcttggagtttgcttacgactacaagtgaatccccaaaacaaa
aatcaatttcatggaataagtccagagagaggatttgcagattttatttttgcacatgta
attctacatcttgttgttatgaatttcattggttaa

DBGET integrated database retrieval system