KEGG   Aeromonas media: B224_0122Help
Entry
B224_0122         CDS       T03075                                 

Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amed  Aeromonas media
Pathway
amed00010  Glycolysis / Gluconeogenesis
amed00020  Citrate cycle (TCA cycle)
amed00620  Pyruvate metabolism
amed01100  Metabolic pathways
amed01110  Biosynthesis of secondary metabolites
amed01120  Microbial metabolism in diverse environments
amed01130  Biosynthesis of antibiotics
amed01200  Carbon metabolism
Module
amed_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B224_0122
   00020 Citrate cycle (TCA cycle)
    B224_0122
   00620 Pyruvate metabolism
    B224_0122
Enzymes [BR:amed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B224_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: AHX59372
UniProt: A0A023RDM7
Position
94949..96835
Genome map
AA seq 628 aa AA seqDB search
MSKQIMVPDIGADEVEVTEIMVAVGDKVELDQSLIAVEGDKASMEVPAPAAGIVKEILIK
VGDKVATGSQIMIFEAEGAAAAPAQAAAPVAAAPAAPVAAAAKDVHVPDIGDDEVEVTEI
MVAVGDMVEADQSIIAVEGDKASMEVPAPFAGRVVEIKVAAGAKVSTGSLVMVFEVAGAA
PAAVAAPVQAAAPVAAAPVAAAAKEVNVPDIGGDEVEVTEIMVAVGDKVEADQSLIAVEG
DKASMEVPAPFAGVVKEIKVKAGDKVSTGSLIMVFEVAGAAPAASPVAQAAAPVAAAPAA
APVAQAAAPAAAASDFVANDAYVHASPAVRRLAREFGVNLAKVKASGRKGRIVKEDVQAY
VKDAVKRAESAPAAGQGTGNGMSVVAWPKVDFSKFGPVEELELTRIQKISGPALHRNWAM
IPHVTQFDEADTTDLEAFRKEQNILAEKQKLDVKITPLVFILKAAAKALEAHPRFCSALS
EDGSKLIMKKYIHIGVAVDTPGGLVVPVVRDVNKKGIHELSRDLAEISKKARAGKLTAAD
MQGGCFTISSLGGIGGTSFTPIVNAPEVAILGVSKSEMKPKWNGKEFVPRLMLPLALSYD
HRVIDGADGARFITTLSGVLSDIRRLVL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacagattatggtgccggatatcggtgccgatgaagtggaagtgaccgagatc
atggtcgccgtgggtgacaaggtcgaactggaccagtccctgatcgccgtggaaggtgac
aaggcctccatggaagtcccggctccggccgcaggtatcgtcaaagagatcctgatcaag
gtgggtgacaaggttgccaccggttcccagatcatgatcttcgaagcggaaggcgctgcc
gccgctccggctcaggctgccgctccggttgccgccgcaccggctgcccctgttgctgcc
gctgccaaagacgtgcacgtacctgacatcggtgacgacgaagtcgaagtgaccgagatc
atggttgctgtgggcgacatggttgaagccgaccagtccatcatcgccgtggaaggtgac
aaggcctccatggaagtcccggcgccgttcgcgggccgcgtggtcgagatcaaggttgcc
gctggtgccaaggtatccaccggttccctggtgatggtattcgaagtggctggggccgcg
cctgctgccgttgccgcgccggttcaggctgccgctcccgtggctgctgccccggttgcc
gctgctgccaaagaggtcaacgtacctgacatcggtggcgatgaagtggaagtcaccgag
atcatggtggccgtgggtgacaaggtcgaagccgaccagtccctgatcgccgtggaaggt
gacaaggcctccatggaagtgcctgcaccgttcgccggtgtggtcaaggaaatcaaggtc
aaggccggtgacaaggtctccaccggttccctgatcatggtgttcgaagtcgctggtgct
gctccagccgcctccccggttgctcaggctgctgcccccgttgccgccgcccctgccgct
gccccggttgctcaggctgcagccccggctgccgctgcctccgatttcgtggccaacgat
gcctatgttcacgcctccccggcggtgcgccgtcttgctcgtgaattcggcgtcaacctg
gccaaggtgaaggcttccggtcgcaagggccgcattgtcaaagaagacgtgcaggcctac
gtgaaggatgcggtcaagcgtgccgagtccgccccggctgcgggtcaaggcactggcaac
ggcatgagcgtcgtggcctggcccaaggttgatttcagcaagttcggcccggtcgaagag
ctggaactgacccggatccagaagatctccggtcctgccctgcaccgcaactgggccatg
atccctcatgtcacccagtttgacgaagcagataccacggatctggaagcgttccgcaaa
gagcagaacatcctggccgagaagcagaagctggacgtgaagatcaccccgctggtgttc
atcctgaaggcggccgccaaggcgctggaagcgcacccgcgcttctgcagcgctctgtcc
gaagacggcagcaagctgatcatgaagaagtacatccacatcggtgtggcggttgacacc
ccgggtggcttggttgtgccggtcgttcgcgacgtcaacaagaagggcatccatgagctg
tcccgcgatctggccgagatctccaagaaggcccgtgccggcaagctgaccgctgccgac
atgcagggcggttgcttcaccatctccagcctgggtggcatcggcggtaccagctttacc
ccgatcgtcaacgcgccggaagtggccatcctgggcgtctccaagtccgagatgaagccg
aagtggaacggcaaggagtttgtgcctcgcctgatgctgccgctggccctgagctatgac
caccgcgtcatcgacggcgccgacggggctcgcttcatcaccaccctgagtggcgtgctg
tccgacattcgtcgactggttctgtaa

DBGET integrated database retrieval system