KEGG   Aeromonas media: B224_0365Help
Entry
B224_0365         CDS       T03075                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
amed  Aeromonas media
Pathway
amed00010  Glycolysis / Gluconeogenesis
amed00030  Pentose phosphate pathway
amed00051  Fructose and mannose metabolism
amed00680  Methane metabolism
amed01100  Metabolic pathways
amed01110  Biosynthesis of secondary metabolites
amed01120  Microbial metabolism in diverse environments
amed01130  Biosynthesis of antibiotics
amed01200  Carbon metabolism
amed01230  Biosynthesis of amino acids
Module
amed_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amed_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B224_0365
   00030 Pentose phosphate pathway
    B224_0365
   00051 Fructose and mannose metabolism
    B224_0365
  09102 Energy metabolism
   00680 Methane metabolism
    B224_0365
Enzymes [BR:amed01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     B224_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AHX59534
UniProt: A0A023RG44
Position
273533..274612
Genome map
AA seq 359 aa AA seqDB search
MSKKIFDFVKPGVITGDDVQKVFAIAKENGFALPAVNCVGTDSVNAVLEAAAKVKAPVIV
QFSNGGAVFTAGKGLKLEGQQAAIIGAISGAKHVHAVAEAYGVPVILHTDHAAKKLLPWI
DGLLEAGEKHFAETGKPLFSSHMLDLSEESLEENIDICCEYLTRMAKMNMTLELELGCTG
GEEDGVDNSHMDQSALYTQPEDVAYAYERLSKISPRFTIAASFGNVHGVYKPGNVKLTPS
ILDASQKYVSEKFGLPAKSLDFVFHGGSGSTLEEIRESISYGVVKMNIDTDTQWATWEGL
LNFYKTNEAYLQGQLGNPEGADKPNKKFYDPRVWLRAGQTSMIARLEKAFSDLNAINVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaaaattttcgacttcgtaaaacccggcgtgatcactggtgatgacgttcag
aaagtgttcgccatcgctaaagagaacggctttgctctgcctgccgtgaactgcgtcggt
accgactccgtcaacgccgtgctggaagctgccgccaaggtcaaagccccggtcatcgtt
cagttctccaacggtggtgccgtgttcaccgccggcaagggtctgaagctggaaggccag
caggctgccatcatcggtgccatctccggtgccaagcacgtgcacgccgttgccgaagcc
tacggtgtaccggtaatcctgcacaccgaccacgccgccaagaagctgctgccgtggatc
gacggtctgctggaagcgggcgagaagcactttgccgagaccggcaagccgctgttctcc
tcccacatgctggatctgtccgaagagtctctggaagagaacatcgacatctgctgcgag
tacctgactcgcatggccaagatgaacatgactctggagctggaactgggttgcaccggt
ggcgaagaagacggtgtggacaacagccacatggatcaatccgccctgtacacccagcct
gaagacgtggcttacgcctacgagcgtctgtccaagatcagcccgcgtttcaccatcgct
gcctccttcggcaacgtgcacggtgtttacaagccgggtaacgtcaagctgaccccgtcc
atcctggacgcttcccagaaatacgtttccgagaagttcggtctgccggccaagtccctg
gacttcgtgttccacggtggctcaggttccaccctggaagagatccgcgaatccatctcc
tacggcgtcgtgaagatgaacatcgataccgacacccagtgggctacctgggaaggtctg
ttgaacttctacaagaccaacgaagcctacctgcaaggccagctgggcaacccggaaggc
gctgacaagccgaacaagaagttctacgatccgcgcgtatggctgcgtgccggtcagact
tccatgatcgcccgtctggagaaagccttctccgacctgaacgccatcaacgtactgtaa

DBGET integrated database retrieval system