KEGG   Aeromonas media: B224_1283Help
Entry
B224_1283         CDS       T03075                                 

Definition
(GenBank) D-serine dehydratase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
amed  Aeromonas media
Pathway
amed00260  Glycine, serine and threonine metabolism
amed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amed00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B224_1283
Enzymes [BR:amed01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     B224_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AHX60197
UniProt: A0A023RFZ1
Position
complement(971516..972847)
Genome map
AA seq 443 aa AA seqDB search
MKNIDVQQLITQFPLVRSLIALEPVTWFNPKATTLAIGLPYVGLDGNDVADASARLARFA
PYMCDAFPETRVSKGILESEIAAIPAMQATLNARYGIEVTGKLLLKKDSHLPISGSIKAR
GGIYEVLTHAERLAIKAGLLCEEDDYRKLFTDEFRQFFGQYSIAVGSTGNLGMSIGIMSA
KLGFTVTVHMSADAREWKKRKLREHGVIVVEYAEDYGVAVEQGRKEAERDPNCFFIDDEN
SRTLFLGYSVAGERVKKQFDEMGIKVDAEHPLFVYLPCGVGGGPGGVAFGLKLAFGDHVH
CFFAEPTHSPCMLLGVHTGLHDAIAVQDLGIDNLTAADGLAVGRASGFVGRAMERLLSGF
YTLSDQEMYDLLGLLARDEQIKLEPSALAGMPGPWRVSADGEWQTSHGLDARRMMQATHL
VWATGGGMVPAEEMEKYLATAHL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatcgacgtccaacaactcattacccaattcccgctggttcgctccctgatc
gcactcgaacccgtgacctggttcaaccccaaggccaccacgctggcgatcggtctgccc
tatgtgggcctggatggcaacgatgtggcggatgcctccgcccgcctcgcccgcttcgcc
ccctacatgtgcgacgccttccccgagacccgcgtcagcaagggcattctggagtccgag
atagcggccatcccggccatgcaggcaacgctcaatgcgcgttacggcatcgaggtaacc
ggcaagttgctgctgaaaaaagacagccacctgcccatctccggctccatcaaggcccgt
ggcggcatctatgaggtgctgacccacgccgaacggctggccatcaaggccgggttgctc
tgcgaagaggacgactatcgcaagctgttcacggacgagttccgccagttcttcggccag
tacagcattgcggtgggctcgaccggcaacctcggcatgtccatcggcatcatgagtgcc
aagctcggtttcaccgtcaccgtccacatgtctgccgatgcacgggagtggaagaagcgc
aagttgcgcgaacatggcgtcatcgtggtggaatatgccgaagattacggggtagcggta
gagcagggtcgcaaggaagccgagcgcgatcccaactgcttcttcatcgacgacgagaac
tcccgcaccctgttcctcggctactcggtggccggtgagcgggtgaagaagcagttcgac
gagatgggcatcaaagtggatgccgagcatccgctgttcgtctacctgccctgcggcgtc
ggtggcggcccgggcggcgtggcctttggcctcaagctcgcatttggggaccatgtgcac
tgcttcttcgccgagccgacccactccccctgcatgttgctcggggtccataccggcttg
cacgatgccattgcagtgcaggatctggggatcgacaacctcaccgccgccgacggtctc
gcggtggggcgcgcctccggtttcgtcggccgcgccatggagcggctgctgtcaggcttc
tacaccctgagcgatcaggagatgtatgacctgctggggctgctggcgcgggacgaacag
atcaagctcgagccttccgccctggcaggcatgccgggcccctggcgggtcagtgccgat
ggcgagtggcagacatcgcacggtctggatgcccgacgcatgatgcaggccacccacctg
gtctgggccaccggcggtggcatggtgcccgccgaggagatggaaaaatacctcgccact
gcccatctctga

DBGET integrated database retrieval system