KEGG   Aeromonas media: B224_2141Help
Entry
B224_2141         CDS       T03075                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amed  Aeromonas media
Pathway
amed00071  Fatty acid degradation
amed00072  Synthesis and degradation of ketone bodies
amed00280  Valine, leucine and isoleucine degradation
amed00310  Lysine degradation
amed00362  Benzoate degradation
amed00380  Tryptophan metabolism
amed00620  Pyruvate metabolism
amed00630  Glyoxylate and dicarboxylate metabolism
amed00640  Propanoate metabolism
amed00650  Butanoate metabolism
amed00900  Terpenoid backbone biosynthesis
amed01100  Metabolic pathways
amed01110  Biosynthesis of secondary metabolites
amed01120  Microbial metabolism in diverse environments
amed01130  Biosynthesis of antibiotics
amed01200  Carbon metabolism
amed01212  Fatty acid metabolism
amed02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B224_2141
   00630 Glyoxylate and dicarboxylate metabolism
    B224_2141
   00640 Propanoate metabolism
    B224_2141
   00650 Butanoate metabolism
    B224_2141
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B224_2141
   00072 Synthesis and degradation of ketone bodies
    B224_2141
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B224_2141
   00310 Lysine degradation
    B224_2141
   00380 Tryptophan metabolism
    B224_2141
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B224_2141
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B224_2141
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B224_2141
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amed04147]
    B224_2141
Enzymes [BR:amed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B224_2141
Exosome [BR:amed04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B224_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHX60819
UniProt: A0A023RJQ5
Position
1678729..1679892
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALSTLSAPELGACAIRAALAAAGMGGDRVDEVYLGNVLSAGV
GQAPARQAALKAGLPDSVPCTTLNKVCGSGMKAVMLAADALRLGEVDVVVAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGHLMGHYAQLSADRAGLTRADMDAFAIA
SLERALAAQRSGAFGAELAPVMAADTLLLADDEQPGKARPDKIPTLKPAFSKTGTITAAN
ASSISDGAAALVLMRAETAHQLGLPVLARVVGYQSHAALPAEFTSAPVGAIDKLLARVGW
SVEEVDLFEVNEAFAMVSMLAMAGCQIPHHKLNVNGGACALGHPLGASGARILVTLIHAL
RTRGLRRGVASLCIGGGEATAMAIELV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgtggcagccaaacgtacccccatgggggccttccagggggccttg
agcacactgagtgctccggagctcggcgcctgcgccatccgcgccgccctggcggcggcc
gggatggggggggatcgggtcgatgaggtctatctgggcaatgtgctgagcgccggggtc
gggcaggcaccggcccggcaggcggcactcaaggccgggctgccggacagcgtgccctgc
accaccctcaacaaggtgtgcggctccggcatgaaggcggtgatgctggcggcagacgcg
ctgcggctgggggaggtggacgtggtggtggcgggcggcatggagagcatgagccgggcc
ccctatttgctggacaaggcgcgcagcggttttcgcatgggccatcagagcgtgctggat
cacatgttcctcgacggcttgcaggatgcctacgaggggcacctgatgggccactacgcc
cagctgagcgcggacagggccgggctgacccgggccgacatggatgccttcgccatcgcc
tccctggagcgggccttggcggcgcagcgaagcggcgccttcggggcagagctggcgccc
gtgatggcggcagacaccctgctgctggccgatgacgagcaaccggggaaggccaggccc
gacaagataccgaccctgaaaccggccttcagcaagacgggcaccatcacggcggccaat
gccagctccatctcggacggggcggcggcgctggtgctgatgcgggccgagacggcccat
caactgggcttgccggtgctggccagggtggtgggataccagagccatgccgccctgccg
gcggagtttaccagcgccccggtgggggccatcgacaagttgctggcccgggtgggctgg
tcggtagaggaggtggatttgttcgaggtgaacgaggccttcgccatggtgagcatgctg
gcgatggcggggtgccagatcccccatcacaagctgaacgtgaacggaggcgcctgcgcc
ctggggcatcccctgggggccagcggtgcccgcatcctggtgactctgatccatgccctg
cgcacgcgcgggctcaggcgaggggtggcgagtctgtgcatcgggggcggagaggcgacg
gccatggccatcgagctggtgtga

DBGET integrated database retrieval system