KEGG   Aeromonas media: B224_4098Help
Entry
B224_4098         CDS       T03075                                 

Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
amed  Aeromonas media
Brite
KEGG Orthology (KO) [BR:amed00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:amed03009]
    B224_4098
Enzymes [BR:amed01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     B224_4098
Ribosome biogenesis [BR:amed03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    B224_4098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Mei5_like
Motif
Other DBs
NCBI-ProteinID: AHX62225
UniProt: A0A023RMM3
Position
complement(3222995..3224089)
Genome map
AA seq 364 aa AA seqDB search
MNNLLLYCRPGFEKEAAAEITERASNMQCYGFARVKDDSGYVIFELYDEEQADLLARKLP
FRELIFIRQMLVVTHELKDLDLSDRVSPIIEATRDYAICGDLRVETADTNEAKELSAFCR
KFTVPLRQALRSNEILTKKETPHRPVFHAFFMANDHLLLGYSYSFNNSEFHMGIPRLRCP
PDAPSRSSLKLEEAFYVFVPREEWELRLTSGMKAVDLGACPGGWTYQLVRRGMMVTAVDN
GSMAQSLMDTGQVKHIRDDGFVWRPGKKNTYWLVCDMVDKPARVVHMIADWFRENDCQEA
MFNLKLPMKKRYAEAVHNIEVLREMLKEIDNAFVIQAKQLYHDREEITVHVYNKFWVSKL
EPKS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctgctgctttattgccgcccgggttttgagaaagaggcggcggcagagatc
accgaacgagccagcaacatgcagtgctacggcttcgcccgggtcaaggacgacagcggt
tacgtgattttcgaactgtatgacgaggagcaggcggatctgctggcccgcaagctgccg
ttccgtgagctcatcttcatccgccagatgctggtggtgacccatgagctgaaggatctg
gacctctccgatcgggtttcccccatcatagaggcgacccgtgactatgccatctgtggc
gatctgcgggtggagacggccgacaccaacgaggcgaaggagctctctgccttctgccgc
aagttcacggtgccgctgcgccaggcgctgcgcagcaacgagatcctgaccaagaaggag
acgccgcaccgtccggtgttccacgccttcttcatggccaatgatcacctgctgctgggg
tactcctactccttcaacaactccgaattccacatgggcattccgcgcctgcgctgcccg
ccggacgccccgagtcgctccagcctcaagttggaagaggccttctatgtgttcgtgcca
agggaagagtgggagctgcgcctcacctccggcatgaaggccgtggatctgggcgcctgc
ccgggcggctggacctatcagctggtgcgccgcggcatgatggtgaccgcggtggacaac
ggttccatggcccagtccctgatggataccggccaggtcaagcacattcgcgacgacggt
ttcgtctggcggccaggcaagaagaacacctactggctggtgtgcgacatggtggacaag
ccggcgcgggtggtccacatgattgccgactggttccgcgagaacgactgccaggaggcc
atgttcaacctcaagctgccgatgaagaagcgctatgccgaggcggtgcacaacatagag
gtgctgcgggagatgctcaaggagatcgacaatgcgttcgtgatccaggccaagcagctc
taccacgatcgcgaagagatcaccgtgcacgtctacaacaagttctgggtctccaagctc
gaacccaagtcctga

DBGET integrated database retrieval system