KEGG   Aeromonas media: B224_5496Help
Entry
B224_5496         CDS       T03075                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
amed  Aeromonas media
Pathway
amed00860  Porphyrin and chlorophyll metabolism
amed01100  Metabolic pathways
amed01110  Biosynthesis of secondary metabolites
Module
amed_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:amed00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B224_5496
Enzymes [BR:amed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     B224_5496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AHX63207
UniProt: A0A023RPS2
Position
4296878..4298251
Genome map
AA seq 457 aa AA seqDB search
MQAEQIVWDQALIEKYNYSGPRYTSYPTALEFNEGFGYPDFVQAAGQYPARNLSLYVHIP
FCHKLCYYCGCNKVITRHQHKADQYLDYLEQEIKAQAPLFKDRLVTQLHWGGGTPTYLNE
GQTRRLMAILREHFQFADAGEISIEVDPREIELSMLDVLRELGFNRISLGVQDFNKAVQV
AVNREQDNDFIRAMLERARSLGFRSTNLDLIYGLPHQNRESFHHTLEEVLKTDPARLSIF
NYAHLPSRFAAQHKLKEEDMPAPREKLAMLQDTIAFLTGQGYQFIGMDHFAKPDDELAVA
QREGKLHRNFQGYTTQGDCDLLGLGVSSISMMGDAYSQNQKDLKTYYAQVETLGHAQWKG
CSLNRDDLIRREVIKRLICDFSLNFAAVEQAHGLVFKEYFAEDLKLLQTFIDDGLVRMND
DGLEVVSTGQLLIRNICMCFDVYLRSKARQQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcagaacagattgtgtgggatcaggccctgatcgagaaatataactacagcggc
ccacgttacacctcctatcccaccgcattggagttcaacgagggcttcggttatccggac
ttcgtccaggccgcgggccagtatccggcgcgcaatttgtcgctctacgtgcacatcccc
ttctgccacaagctgtgctactactgcggctgcaacaaggtgatcacccgtcaccagcac
aaggccgatcaatacctcgattacctcgagcaggagatcaaggcacaggcccccctgttc
aaggaccggctggtgacccagctgcactggggcggcggtacccccacctacctgaacgag
gggcaaacccgtcgcctgatggccatcttgcgggagcacttccagtttgcggacgcaggg
gagatcagcatcgaggtcgacccgcgcgagatcgaactctccatgctggatgtgctgcgg
gagctcggtttcaaccgcatcagcctcggcgtgcaggatttcaacaaggcggtccaggtc
gcggtcaaccgtgagcaggacaacgacttcatccgcgccatgctggagcgcgcccgatca
ttggggttccgctccaccaatctcgacctcatctacggcctgccgcaccagaaccgggag
agcttccaccacaccctggaggaagttctcaagacggatccagcccgtctctccatcttc
aactatgcgcacctgccgagccgctttgccgcccagcacaagctgaaggaggaagacatg
ccggcccctcgggagaagctggccatgctgcaggacaccatcgccttcctcaccggtcag
ggttatcagttcatcggcatggatcacttcgccaagcccgatgacgaactggcggtggcc
cagcgcgagggcaagctgcatcgcaacttccagggctataccacccagggggattgcgat
ctgctggggttgggggtctcttccatcagcatgatgggggatgcctactcccagaatcag
aaggatctcaagacctattacgcccaggtggagacgctcggtcatgcccagtggaagggg
tgctccctcaaccgggacgatctgatccgccgcgaggtgatcaagcgcctcatctgcgac
ttctccctgaacttcgccgccgtcgagcaggcccatggtctggtcttcaaggagtatttc
gccgaggacctcaagctgctgcagaccttcatcgatgatggcctggtgcgtatgaacgac
gacgggctggaggtggtctccaccggtcagctgctcattcgcaacatctgcatgtgcttc
gacgtctacctgcgcagcaaggcgcgtcagcagcagttctcccgggtgatctga

DBGET integrated database retrieval system