KEGG   Astyanax mexicanus (Mexican tetra): 103021866Help
Entry
103021866         CDS       T05042                                 

Definition
(RefSeq) dihydropteridine reductase-like
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00790  Folate biosynthesis
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103021866
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     103021866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase adh_short adh_short_C2
Motif
Other DBs
NCBI-GeneID: 103021866
NCBI-ProteinID: XP_022539709
Position
24
AA seq 239 aa AA seqDB search
MAATPAGRVLVYGGRGALGSACLHYFKAKGWWVASIDIVANEEANANVLVKICESFTEQA
EQVTSDVARLLGEQKVDAILCLAGGWAGGNCSSKDLYKNSDLMWKQSVWTSTISSHLASK
HLKAGGLLTLAGANASLSGTPGMVGYGMAKAAVHQLCQSLSGENSGLPAGSVAVAILPVT
LDTPMNRKFMPDADFSSWTPLEYIAQTFYSWATGSGRPASGSLIQLVTAGGVTEATPVH
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccgctaccccggcaggtcgtgtgttggtgtacggaggcagaggcgcgctgggctcg
gcgtgtcttcactactttaaggctaaaggctggtgggtggccagtattgatatcgtggcg
aatgaagaagcgaacgcgaatgttctggttaaaatctgcgagtctttcactgaacaggcg
gaacaggtgacatcggacgtggctcggttgctgggggagcagaaggttgatgctattttg
tgtttggcagggggatgggctggaggaaactgcagctcgaaagacctgtataagaacagt
gatctgatgtggaagcagagtgtctggacctccaccatctccagtcatctggcctctaag
cacctgaaggctggtggtctgctcaccctggctggagccaatgcttcactgtctggaact
ccaggtatggtgggttatggcatggctaaagctgcagtgcatcagctgtgtcagagtctg
tctggagagaacagtggtctcccggctggatccgtggctgtagccattctaccggttacc
ttggatacgccgatgaacaggaaattcatgccagacgcagacttcagctcctggacccct
ctggagtacattgcccaaaccttctacagctgggccactggttcagggcggccagcttca
ggcagtctgatccagctggtgacggcaggaggagtaacggaggccacaccggttcactaa

DBGET integrated database retrieval system