KEGG   Astyanax mexicanus (Mexican tetra): 103022196Help
Entry
103022196         CDS       T05042                                 

Gene name
suclg2
Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00020  Citrate cycle (TCA cycle)
amex00640  Propanoate metabolism
amex01100  Metabolic pathways
amex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103022196 (suclg2)
   00640 Propanoate metabolism
    103022196 (suclg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amex04147]
    103022196 (suclg2)
Enzymes [BR:amex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103022196 (suclg2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103022196 (suclg2)
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103022196 (suclg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 103022196
NCBI-ProteinID: XP_022538095
Position
22
AA seq 429 aa AA seqDB search
MAACMMWRAVQSGAERAGRLLRTRQVVKVSPRRWLNLQEYQSKKLMQDSGVTVQRFFVAD
TADEALQAAKRLNAKEIVLKAQILAGGRGKGVFDSGLKGGVHLTKDPAVVGDLAGKMLGF
NLTTKQTPKDGVKVKTVMVAEALDISRETYFAILMDRACNGPVMVGSPQGGVDIEEVAAK
TPELIFKEPIDIFEGVRDDQARRMAANLGFKGPLETQAADQIKKLYDLFLKVDATQVEVN
PLGETPQGQVVCFDAKINFDDNAEFRQKAVFAMDDTAESDPTETEAAKYDLKYIGLDGNI
ACFVNGAGLAMATCDIIDLHGGKPANFLDLGGGVKENQVYAAFKLLTADPKVEAILVNIF
GGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAKRILSESGLPITAASDLDDAAR
KAVAAIAKK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtgcatgatgtggagagcggtgcagagcggagctgagcgcgcgggccggtta
ctgcgcacgagacaggtggtcaaggtgagccccagaagatggctgaaccttcaggagtat
cagagcaagaagctgatgcaggacagcggagtgacggtccagcgcttcttcgtggccgac
accgctgacgaagccctgcaggctgcaaagaggctcaatgctaaagagattgttctgaag
gctcagattctggcaggaggtcggggtaaaggagtctttgacagcggcctgaaaggaggt
gtgcacttaaccaaagaccctgcagtggtgggcgatttggctggcaagatgctcggcttc
aacctgaccaccaagcagacccctaaggacggcgtgaaagtaaaaacggtgatggtggcg
gaggctttggacatctccagagaaacatactttgctatcctgatggaccgggcgtgtaac
gggcctgttatggtgggcagtccgcagggtggagtggacatagaggaggtagcagccaaa
acaccagagctcatattcaaggaacccatagatattttcgaaggtgttcgagacgaccag
gctcggcgcatggcagctaatttgggcttcaaagggccgctggagactcaggctgcagat
cagattaagaagctctatgatctgttcctgaaagtcgacgccactcaagtggaagtcaat
cctctcggggagactccccaaggacaagttgtttgctttgatgccaaaatcaactttgac
gacaacgcagagttccgccagaaagccgtcttcgccatggacgacacggccgagagtgac
cccacagaaacagaggcggccaaatatgacctcaaatacatcggcctggacggcaacatc
gcctgctttgtcaatggcgccggtctcgcaatggcaacctgtgacatcatcgacctgcat
ggcgggaaaccggcgaacttcttggacctgggaggtggggtgaaggagaaccaggtctat
gcagccttcaaactgctgactgccgacccaaaggtagaggccattctggtgaacatcttt
ggcggtattgtgaactgtgccatcatcgctaacggcatcacgaaagcctgcagagagctg
gagctcaaggtgcccttggtcgtccggctggaaggtacgaacgtgcaggaggctaagcgg
atcctgtcggagagcggcctgcccatcactgctgccagcgacctggacgacgcagccagg
aaagcagtagccgctatcgctaagaaataa

DBGET integrated database retrieval system