KEGG   Astyanax mexicanus (Mexican tetra): 103022427
Entry
103022427         CDS       T05042                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00100  Steroid biosynthesis
amex01100  Metabolic pathways
Module
amex_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103022427
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103022427
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103022427
NCBI-ProteinID: XP_022524094
Ensembl: ENSAMXG00000000828
Position
Unknown
AA seq 431 aa
MDQQNRSDQMKNSVGTRGQGEEPAAKPDHSEWNQVYLAVVSVLLGPVLLVLLDGCSAVEP
GRLWAESDGVGVALWDWTAFTIVVIFTVLQGALYYLPVGQVVEGKMGNQEKRLKYSLNGL
HAFGVCVVLLVGAWQGGWLVAGSVTGRVLPLVSAGCAVALLISVCLYLRPDSAHSHENTT
GGFLQDFLLGREADPRLGKIDVKQFAMVRIGFIGWGLMDVCYVLRGVESDSVSSALLLTT
TFQLVYILDFLIDEDTVLDTKEFMEDSIGFLMVLGEYIWIPFFSSLPVYFLLQRPNHIHF
LSAVPVILLFGFGFLVYYLSNEQKSGFRRNPHNPAYSRLETIRSPSGRNLLVSGWFGWVR
HPNYLGDVVMMLAWCLPCGFCSVLPYLPALQCFNLLRKRSTEVEESCREKHGSAWAEYCR
RVPYKLIPYIY
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggatcagcagaaccgatcggatcagatgaagaacagtgtggggacccgaggtcagggg
gaggagcctgcagctaaaccggatcacagcgagtggaaccaagtctacctggcggtggtg
agtgtgttgttggggccggttctgctggttctgctggacggctgtagtgcagtggaaccg
ggcaggttgtgggcggagtctgatggagtgggcgtggcactgtgggactggacagcgttc
actatagtggtgatattcactgtgctgcagggggcactatactatctacctgtgggacag
gtggtggagggtaagatgggtaatcaggagaagagattgaagtatagtctgaacggtctg
cacgcgtttggagtgtgtgtggtgctgctggttggggcgtggcagggcgggtggctggtg
gcgggcagtgtgacgggcagggtgctgccgctggtcagtgccgggtgtgccgtcgctctg
ctgatcagcgtgtgtctctacctgcgcccagactccgcccacagtcacgagaacaccaca
ggtgggttcctgcaggacttcctgttgggccgggaggcggaccctcggctcggtaagatc
gatgtgaagcagttcgccatggtcagaatcggcttcatcggctggggtttgatggatgtg
tgttatgttctgaggggggtggagtcggactccgtctcctcagctcttctcctcaccacc
accttccagctcgtctatatcctcgacttcctcatcgacgaggacacggtgttggacact
aaggagtttatggaggactcgatcgggttcctgatggttctgggagagtatatctggatc
ccgttcttctccagcctccccgtttacttcctgctccagcggcccaatcacatccacttc
ctgtctgctgttcccgtgatcctgctgtttggtttcgggttcctggtgtattatctctcc
aacgagcagaagagcggcttccgcaggaacccccataaccccgcctactcccgtctggag
acgatccgcagtccgtcgggtcggaacctgctggtgtccggatggttcggttgggttcga
catccaaactacctgggcgacgttgtgatgatgctggcctggtgtttaccctgcgggttc
tgcagtgtgttgccgtacctgccggctctgcagtgttttaatctgttgaggaagaggagt
acggaggtggaggagtcgtgccgggagaaacacggctcagcgtgggcggagtactgccgc
cgagttccatacaaactcataccctacatctactga

DBGET integrated database retrieval system