KEGG   Astyanax mexicanus (Mexican tetra): 103023450Help
Entry
103023450         CDS       T05042                                 

Gene name
atg16l1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04136  Autophagy - other
amex04140  Autophagy - animal
amex04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103023450 (atg16l1)
   04136 Autophagy - other
    103023450 (atg16l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103023450 (atg16l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amex04131]
    103023450 (atg16l1)
   03029 Mitochondrial biogenesis [BR:amex03029]
    103023450 (atg16l1)
Membrane trafficking [BR:amex04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    103023450 (atg16l1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    103023450 (atg16l1)
Mitochondrial biogenesis [BR:amex03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    103023450 (atg16l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 Ge1_WD40 KASH_CCD DUF4472 ADIP PspA_IM30 Cytochrom_D1 DUF3584 Bacillus_HBL Fez1
Motif
Other DBs
NCBI-GeneID: 103023450
NCBI-ProteinID: XP_022525992
Position
1
AA seq 602 aa AA seqDB search
MAGRRVECTWKRHVVEQLKLRDRVQRQAFEELIHQYNRLLEKSDLQGVLSERLQTEKYEL
QNRHDLSPGAESLQQEMAQIRIRHQEELTELHKKRGELAQSVIELNYQIQQKDKEIQSNE
AKMLEYQQQISQLEGECRDLRNSLADLERANQTLRDEYDALQITFSALEEKLRKTTEDNQ
ELVTRWMAEKAQEANRLNAENEKDCRRRQAKLQKDLADAAKEPLPIDPEDDIEVLSSEDS
AKAPGETSPSRLPSRAPSKRLSQPPPAGLLDSISNIFGRRRSLNSHGTSPDSSDVPSGVC
AEVRVPSTALHTFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWEVVAGRCEPKGALTGS
NAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSARFLLDNARIVS
GSYDRTLKLWDLRSKVCMKTVFAGSSCNDIVCTEQCVMSGHFDKKVRFWDIRAESIVCEL
ELLGRVTSLDLNHDRTELLTCSRDDLVKIIDLRNNSVRQTFSAQGFKCGSDFTRVTFSPD
GGYVAAGSADGVLYVWNVLTGKLDKTLDKNHSSAINSVSWSPSGTYVVSVEKGSKAVLWS
DL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacgcagggtggagtgtacgtggaagagacacgttgtggagcagctaaagctg
agggaccgagtgcagcggcaggcatttgaggagctcatacaccagtataacaggttgctg
gagaagtctgatctgcagggagttctgtcagagaggctgcagactgagaagtatgagctg
cagaacagacatgacctcagcccaggcgctgagtctctgcagcaggaaatggctcagatc
cgaattcggcaccaggaggaactcacagagctccacaagaagcgtggagagttggcccaa
agtgtgattgaactaaattatcagattcagcagaaggacaaagaaatccagagcaatgag
gccaagatgttggagtatcagcagcagatctctcagctagagggggaatgtcgtgatttg
cggaactctctagcggatttggagcgagccaatcagactctgcgcgatgaatacgatgct
ctgcagatcacgttcagcgctctggaggaaaaactgaggaaaaccacagaggataatcag
gagctggtgacccgctggatggcagaaaaagctcaggaggccaacagactcaatgctgag
aacgagaaggactgcaggcgcagacaagctaaattgcagaaggatctggcagatgctgcc
aaagagccactgcctattgacccggaagatgacatcgaggtcctttcttcagaggactct
gcaaaagcaccaggagagacgtctccaagcagactgcccagccgagcacctagtaaacgt
ctgtctcaacctccccctgctggactgctggactccatctccaacatcttcggaaggcgt
cgctcgctgaattctcatgggacgtctccagatagttcggatgttccgtctggagtgtgc
gcggaggtccgagtgccatccactgcgctgcacaccttcgatgcacacgacggcgaggtt
aacgcagtgaggttcagtcctggatcccgtctcctagcaacaggagggatggaccgtcgg
gtgaagctgtgggaggtggtagcaggtcgatgtgaacctaagggggcactgacgggcagt
aacgctggaatcaccagtattgagtttgacagcgctggctcatatcttctggctgcatcc
aacgacttcgccagcagaatctggactgtagacgactacaggctgaggcacacactgacc
ggccacagcgggaaggttctgtctgcacggtttctgctggataacgctcgcatcgtctcc
ggcagctatgaccggacactcaaactctgggatctgcgcagcaaagtctgtatgaagacg
gtgtttgcgggctccagctgtaacgacattgtgtgcacggagcagtgcgtgatgagcgga
cacttcgataagaaggttcgattctgggatatccgggctgagagtatagtgtgtgagttg
gagctgttgggtcgtgttacgtctttagacctgaatcacgatcgaacggaactgctcacc
tgttcccgtgacgacctggtaaaaattattgacctacgcaacaactctgtgcggcagacc
ttcagtgctcagggcttcaagtgtggctctgacttcacccgagttacctttagtcctgat
gggggttatgtagctgcgggttctgcagatggtgttctgtacgtgtggaacgttctcaca
gggaaactcgacaaaaccctggataagaatcacagctctgctattaactctgtgtcctgg
tctccgtcgggaacctacgtggtcagtgtggagaagggcagcaaggcggtgctttggtct
gacctgtga

DBGET integrated database retrieval system