KEGG   Astyanax mexicanus (Mexican tetra): 103024512Help
Entry
103024512         CDS       T05042                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2-like
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04218  Cellular senescence
amex04370  VEGF signaling pathway
amex04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103024512
   04370 VEGF signaling pathway
    103024512
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103024512
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103024512
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103024512
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103024512
Protein kinases [BR:amex01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   103024512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 103024512
NCBI-ProteinID: XP_022526393
Position
6
AA seq 377 aa AA seqDB search
MFLNTQSDPEAAGQQEGLLSPQPAHKLSQRIKKKVITEDYKLSGQVLGVGLSGKVFEIFQ
RNTGEKFALKMLKDNPKARREAELHCRASVCPRIVRIADVFDNFYQGKKCLLLVMECMDG
GELFRRIQARREQAFTEREASAIMKNIGEAIEFLHSINIAHRDVKPENLLYTSSHPDAQL
KLTDFGFAKETTTQSCLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPF
YSNHGVTLSPGMKKRIRNGQYEFPNPEWSDVSEEAKQLIRQLLKTDPTERMTITEFMRHP
WINRSMNVPQTALHTSQVLAEESHVWEEVKEEMTNALATMRVDYEQVKIKTIEDSSNPLL
MKRRKKLANAPPESPGL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttcctaaacactcagagtgaccccgaggctgccggacagcaggaggggctcctgtcc
ccccagcccgctcacaaactcagccagaggatcaagaagaaagtgatcactgaggactat
aagctctcagggcaggtgcttggagttggcctcagtggaaaagtcttcgagatctttcag
agaaacacgggagagaagttcgctctgaagatgttgaaggacaatccgaaagctcgtagg
gaggcggagcttcactgtagggcgtctgtgtgtccccggattgtgcgcatcgctgacgtc
ttcgataacttctaccaggggaagaagtgtcttcttctcgtcatggaatgcatggacgga
ggtgaactattcagacgtattcaggcacggcgtgagcaggctttcactgagagagaggcc
tcggctattatgaagaacataggagaagccattgagtttctacattccattaacatagca
cacagagacgttaagccggagaatctgctctatacatcatcacatcctgacgctcaactc
aagctcacagacttcggattcgccaaagagaccacaacccagagctgcctggccacgccc
tgctacaccccctactatgtggcccctgaggttctcggtcctgaaaaatatgacaagtca
tgtgacatgtggtcactgggcgtcatcatgtacatactattgtgtggatatccacccttt
tactcaaaccacggcgtgacgctgtcccccggaatgaagaaacggatacggaacggccag
tacgagttccccaaccctgaatggtcagacgtgtcagaagaagcaaagcagctgattcgc
caactactgaaaactgaccctacagagagaatgaccatcaccgagttcatgcgccatccc
tggatcaatcgatcaatgaatgtacctcagactgctctccacaccagtcaggtcctggca
gaagaaagccatgtctgggaggaagtcaaggaagagatgaccaatgccttggccacaatg
agagtggactacgagcaagtcaaaatcaagaccatcgaggactcgtccaatccacttctt
atgaagagaaggaagaaattagctaatgcaccaccagaatcaccagggctataa

DBGET integrated database retrieval system