KEGG   Astyanax mexicanus (Mexican tetra): 103025036Help
Entry
103025036         CDS       T05042                                 

Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-2
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103025036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amex04040]
    103025036
Ion channels [BR:amex04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   103025036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Claudin_2
Motif
Other DBs
NCBI-GeneID: 103025036
NCBI-ProteinID: XP_007240218
Ensembl: ENSAMXG00000018597
Position
5
AA seq 621 aa AA seqDB search
MSPARSFQLVLIICLQHGYVCTLTPARAHAEERLLQVLFSRYNKLSRPVANISDVVLVHF
GLSIAQLIDVDEKNQMMTTNVWVKQEWSDYKLRWNPEEYENVTSIRIPSELIWRPDIVLY
NNADGDFAVTHLTKAQLFHDGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDR
AKIDLVSMDDDVDQMDYWESGEWVIINAVGKYNTKKYECCTEIYPDITYSFIIRRLPLFY
TINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLI
GEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHRMPHWVRQLFLQLVPRYLFMKRPPASGK
RNCRKLIEMMHKPVMPQAMLLGATTLPPSENPCPDPDGVSAAQSGGLQREPASKTPLFCS
SPSSQYSILQEEPTQAPQTPELRFPPTHNSSPSSLSLSPDTPLGSLLHTLPLTEICELYR
HSAESVFVDSKEGLPETETLRHCRKHEGAAIKTHCIAEGGGSTGQGSRHNLLDTQNSSNN
CSKEPKTEEVEIPISQSLLRALEGVQYIADHLRAEDSDFSVREDWKYVAMVIDRIFLWMF
VLVCILGTAGLFLPPWLAGMI
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagtccagccaggagcttccagctagtcctgatcatctgccttcagcacggttacgtg
tgcacactaacaccagcacgcgctcatgcagaggagagactgctgcaggttttattcagc
cgctacaacaagctctctcgccctgtagcgaacatctccgacgtggtgctggtccacttt
ggcctctccattgcgcagcttattgatgtagacgagaagaaccagatgatgaccaccaat
gtgtgggtgaaacaggaatggagcgattacaagctgcgctggaaccctgaggagtatgag
aatgtcacctccatcagaatcccctcagagctcatctggagacccgatattgttctttat
aacaatgctgatggggattttgctgtgacacacctcaccaaagcccagctgttccacgat
ggcagaatcaaatggaagcctccggctatatacaaaagctcctgcagtattgatgtcacg
ttcttccctttcgatcagcagaactgcaaaatgaagtttggctcgtggacgtacgaccga
gccaagattgacctggtgagcatggatgatgacgtggaccagatggactactgggagagt
ggggagtgggtcatcatcaatgcagtggggaaatacaacaccaagaagtacgagtgctgc
acagagatctaccccgacatcacctattccttcattatccgccggcttcctctgttctac
accatcaacctcatcatcccatgtctgctgatctcctgtttgaccgtcctcgtgttctac
ctaccttcagaatgtgctgagaagatcaccctgtgtatctctgtcctcctgtctctcact
gtcttcctcttgctcatcacagagatcataccttccacatccttggtcatcccgctcatc
ggggaatacctcctcttcaccatgatcttcgtcacactctcaatcatcataacagtgttt
gtgctaaatgttcaccaccgttcctcgcgaacccaccgcatgccacactgggtacgacaa
ctctttctccaactggtgcctcgctacctgttcatgaagcgtccacctgcttccggtaag
aggaattgccggaagctcatcgagatgatgcacaagccggtgatgccacaggccatgttg
cttggagccactacccttcccccctcagagaacccttgccctgatccagatggggtttcc
gccgcccaatctggtgggctacagcgggaaccggcttccaaaactcctctattctgcagc
tccccaagcagccagtactcgatcctacaagaggaacccactcaagcacctcaaacccct
gaactcaggttcccgccaacgcacaactcctccccctccagcctctccttatctccagac
acacccctcggctccctgcttcacacgcttccccttacagaaatatgtgaactctaccgc
cacagcgctgaaagtgtatttgtagactccaaggaaggcttacccgagacagagactctt
cggcactgtcgcaagcatgagggggcagccataaaaacccactgcattgcagaagggggt
ggaagcacagggcaaggctctagacataacctccttgacacacaaaactcaagcaacaac
tgcagcaaagaacccaaaactgaagaagtggagattccaatatctcagtcactgctgcga
gctctcgaaggagtccagtacatagccgaccacctcagagccgaagactctgacttttcg
gtaagagaagactggaagtacgttgccatggtgatcgatagaatattcctgtggatgttt
gtgctggtgtgtattctcgggacagccggactgtttcttcctccatggctggctggaatg
atctag

DBGET integrated database retrieval system