KEGG   Astyanax mexicanus (Mexican tetra): 103025372Help
Entry
103025372         CDS       T05042                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00010  Glycolysis / Gluconeogenesis
amex00562  Inositol phosphate metabolism
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103025372
   00562 Inositol phosphate metabolism
    103025372
Enzymes [BR:amex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103025372
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103025372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103025372
NCBI-ProteinID: XP_007244752
Ensembl: ENSAMXG00000011005
Position
9
AA seq 453 aa AA seqDB search
MAKKHLPTCLIFLVFLGFFSSSHVNAAAIKQEIPANAEFFNTKTRYQDADPFLRENILAI
NVSAVKPPAPACIPIHLTAIIRHGTRFPTAGNVEKIAILDKLVKSEAKGDLSYLPELKAW
KNWYTQETAGHLTAAGRGDQIHLAKRLVKTFPTLLTKSNLLNKRVKFITSSVPRCINSTL
AFQQGLKESLSIPDNEEFKYTVNDTLMRFFASCERLLVTVLNNKEAVVQVTLFEEGPEMS
KVHQRLSDQLQIPYANITLGSVEAAYYLCAYEFSILGLVTPWCKLFDRAEAQVMDYAGDL
GLYWKRGYGHEVNYMSSCVLFHNLFNRLETSINQFKSGQPVSEVVNVQVGHAETLIPLMT
LLGLFKGKISLDANNFAENLHRPFNCSKNVPFAANLMAALWSCPDGFRLQFRVNENPVAL
PGLSYSPLYEEVKKLYADLLQGCNEEEVCRMSN
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaacaccttccaacatgtttaatttttctagtttttctaggctttttctcc
tcaagccacgttaatgctgctgccattaagcaagaaattccagccaacgcagaatttttc
aacaccaaaacccgataccaagatgccgacccgtttttgcgggagaacatcctcgccata
aacgtctctgcggtgaagcctcctgctccagcctgcatccccatccatctcacggccatc
atcaggcacggcaccagattccccactgctggaaacgtcgaaaagatcgccatcttggac
aaactcgtcaagtctgaggccaaaggcgacctgagttacctgccagagctcaaagcctgg
aagaactggtacacgcaggagacggccgggcaccttacggccgcgggaagaggcgaccaa
attcatctggccaaaagactggtcaagacattccccaccctcctgaccaagagcaacctt
ctgaacaaacgggtcaagttcatcacaagctccgtacccagatgtataaacagcaccctc
gctttccaacaaggcctgaaagaatccctcagtattccagataatgaagaattcaaatac
acagtgaacgacacgctgatgcgcttctttgcgtcatgtgaacgcctgctggtgacagtg
cttaacaacaaagaggccgtggtgcaggtcaccctctttgaagaaggcccggagatgagc
aaggttcatcagaggctgtccgaccaactgcagatcccctacgccaacattactctgggc
tcagtggaggcagcgtactacctgtgtgcatatgaattctccatccttggactggtcact
ccctggtgcaagctatttgatcgagcagaagcacaggtgatggactacgctggtgacctg
ggtctgtactggaagaggggttacggccacgaagtcaactacatgtccagctgcgtcctg
ttccacaacctgttcaaccgccttgagacttcaatcaaccaattcaagtctggtcagccc
gtgtcggaggtggttaatgtgcaggttggccacgctgagacgctgatacctttaatgacc
ctcctgggcctcttcaagggcaaaatcagtcttgatgccaacaacttcgctgaaaacctt
caccgcccttttaactgcagcaagaacgtgcccttcgctgctaacctgatggcggcgctg
tggagctgccccgatggctttaggctgcagttccgggtgaatgagaatccagtggctctg
ccaggcctcagctattcacctctgtatgaggaggtcaagaaactatatgctgaccttctg
cagggatgtaatgaagaagaagtctgtcgaatgagcaactaa

DBGET integrated database retrieval system