KEGG   Astyanax mexicanus (Mexican tetra): 103026112Help
Entry
103026112         CDS       T05042                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04060  Cytokine-cytokine receptor interaction
amex04068  FoxO signaling pathway
amex04110  Cell cycle
amex04218  Cellular senescence
amex04350  TGF-beta signaling pathway
amex04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103026112 (tgfb2)
   04350 TGF-beta signaling pathway
    103026112 (tgfb2)
   04068 FoxO signaling pathway
    103026112 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103026112 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103026112 (tgfb2)
   04218 Cellular senescence
    103026112 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103026112 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amex04052]
    103026112 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:amex00536]
    103026112 (tgfb2)
Cytokines and growth factors [BR:amex04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103026112 (tgfb2)
Glycosaminoglycan binding proteins [BR:amex00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103026112 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 103026112
NCBI-ProteinID: XP_007251862
Ensembl: ENSAMXG00000020321
UniProt: A0A3B1KD25
Position
10
AA seq 401 aa AA seqDB search
MNVYVLTLLLALELAPAARGLSTCSTLDMDQFMKKRIEAIRGQILSKLKLTSPPEEYPEP
EDVSRDIIAIYNSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMHRFDPNGNSIPP
NHYNPYFRRLRFDVSPMEKNASNLVKAELRIFRLQNPKARVPEQRVELYQILAHKDLTSP
TQRYIDSKVVRTNTEGEWLSFDVTEAVSEWLLHRDRNSGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDSISGVGKKRRPHLLLMLLPSYRLESQHKSHRQKRALDAAFCSRNV
QDNCCLRSLYIDFKRDLGWRWIHEPKGYNANFCAGACPYLWSADTQHSKVLGLYNTINPE
ASASPCCVSQDLEPLTILYFIGKTPKIEQLSNMIVKSCKCS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtctacgtgctcaccctgctgctcgcgctggagctggcgcccgcggcgcgcggc
ctctccacgtgcagcacgctcgacatggaccagttcatgaagaagcgcatcgaggccatc
cgagggcagatcctcagcaagctcaagctcaccagcccgcccgaggagtacccggagccc
gaggacgtgtcccgggacatcatcgccatctacaacagcacgcgcgacctgctgcaggag
aaagccaacgagcgcgccgccacgtgcgagcgccagcgcagcgaggaggagtactacgcc
aaggaggtgcacaagatcgacatgcaccgcttcgacccaaacgggaattccatccctccg
aaccactacaacccttacttcagaaggctcaggtttgatgtgagccccatggagaagaac
gcctccaacctggtgaaagctgagctgaggatcttcaggctgcagaaccccaaggcccgt
gtgcctgagcagcgcgttgagctttatcagatcctggcccacaaggacctgacttcgccc
acacagcgctacatcgacagcaaggtggtgcggaccaacacggagggcgagtggctgtcg
tttgatgtgacggaggcggtcagcgaatggcttctacacagagacagaaacagtggattc
aagatcagcctgcactgtccctgctgtacgtttgtgccgtcaaataattacatcatccca
aacaagagcgaggagttggaggcccgctttgcagggattgatgatagcatctctggtgta
ggtaaaaagcgtcgcccgcacttgttgctcatgctgcttccttcctaccgcctggagtcc
cagcacaagagccacagacagaaacgagctttggatgctgctttctgctccaggaatgtc
caggacaactgctgcctgcgctcgctctacatcgatttcaagagggacctgggatggagg
tggatccatgagccaaaaggctacaatgccaacttctgtgccggagcatgtccttatctc
tggagtgcagacactcaacatagcaaggtccttggtctatataacaccataaatccagaa
gcgtcggcctctccatgctgtgtatcccaagacttggagcctcttactatcctttacttc
attggcaagactcccaaaattgagcagctttccaacatgatcgtcaagtcctgcaaatgc
agctag

DBGET integrated database retrieval system