KEGG   Astyanax mexicanus (Mexican tetra): 103026344Help
Entry
103026344         CDS       T05042                                 

Definition
(RefSeq) band 3 anion exchange protein-like isoform X2
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amex02000]
    103026344
   04147 Exosome [BR:amex04147]
    103026344
   04090 CD molecules [BR:amex04090]
    103026344
Transporters [BR:amex02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   103026344
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103026344
CD molecules [BR:amex04090]
 Proteins
  103026344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Wzz
Motif
Other DBs
NCBI-GeneID: 103026344
NCBI-ProteinID: XP_007255201
Ensembl: ENSAMXG00000012104
Position
4
AA seq 835 aa AA seqDB search
MKEQNQQGYWQETGRWVGYEENYDLEARHWGPSHISYLTFKSLVQLRRTMNTGVVMLDRE
ERSFSSIAEKIVDEMVSKKEIQSGDREGVLRALMQNCSQSAETQTLTSPLEMQTVAEKRD
ASNRVEASMVLVGALDFLEKPTVAFVRLKEAVVLGSALETPVPVRFLFVLVGPAKGDMDY
HESGRAMAALLADKVFNQAAFQAQNDRELIDAMADFMDCSIVIPPTEIQNEAMLAPIIGF
QKKLLQERLRPSDPQLRIDIKPRKPSIARPPPPEDPLVRTGVLFGGMVRDFKRRYQHYKS
DITDAMNAQVLAAVIFIYFAALSPAITFGGLLADKVDNMIGVSELMLSTAVLGVIFCLVA
AQPVLVIGFSGPLLVFEEAFYAFCKSQDIEYIVGRVWVGVWLIIIVVVIVAVEGSFLVRF
ISRFTQEIFSILISFIFIYETFSKLGKIFKAHPLILNYDHLNNTVEDPWHPVAKTIVDNS
TGNVTIRTVIHERAYPNTALLSMCLMFGCFAIAYYLRIFKNGYFLPGKLRRLMGDFGVPI
AIFLMVAVDINLEDTYTQKLVVPKGLQVSNPAMRGWLINPMGEHKSFPVWMMFACVVPAV
LVFILIFLESQITTLIVSKPERKMAKGSGFHFDLLILVSLGGCAALFGMPWLSAATVRSV
THANALTVMSKGPKPEIEKVLEQRVSGVLVALLVGLSILMEPILKMIPMAALFGIFLYMG
ITSLSGIQLWDRFLLLLVPKKYHPNEPYATKVKTNRMHLYTAIQLVCLAVLWIVKSSPFS
LALPFILILTIPLRMVMTGRIFTEFEMKCLDADDAKVTFEEEPGVDMYSETRMPS
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacagaaccagcagggctactggcaggagacggggcgatgggtaggctacgag
gagaattacgacctggaggccaggcactgggggccgtcccacatatcctacctcaccttc
aagagcctagtgcagctccgaaggaccatgaacactggggtggtgatgctggacagggag
gagcgctcgttctccagtattgctgagaagattgtggatgagatggtcagtaagaaggag
attcagtcgggtgaccgggaaggggtgcttcgagccctaatgcagaactgcagccagtca
gcagagacccagacactgacctcaccactggaaatgcagacggttgcagagaagagagat
gcatctaatagagtagaggcctccatggtgcttgtaggtgcactggactttctggagaag
ccaacagtagcatttgtgcgtctgaaggaggcggtggtcctcgggtctgcactggagact
ccagttcctgtccgcttcctcttcgtgctggtgggccctgccaagggcgacatggactac
catgagagtggccgcgccatggccgccctgctggcagataaagtctttaaccaggcagcc
tttcaggctcagaatgacagagagctgatcgatgccatggccgacttcatggactgcagc
attgtgatcccacccactgagatccagaatgaggccatgcttgcaccaatcattggtttc
cagaagaagctcctgcaggaaaggctccgcccttctgaccctcagctgcgcattgacatc
aagccacgcaaaccctccattgcaagaccccctccaccagaagatccattggtgcgtact
ggtgtcctgtttggaggcatggtcagggatttcaaaagacggtaccagcactacaaaagt
gacatcacagacgccatgaacgcacaagttctcgctgctgtcatctttatctactttgct
gccctttctcctgccatcacttttggaggcctgttagctgacaaagtggacaatatgatt
ggcgtgtctgagctgatgctgtccacagcagttcttggggtcatcttctgtctcgtggct
gcccagccggttctcgtcattggcttctcagggcctctgctggtgtttgaagaggcattc
tatgcgttctgtaagtcccaggacattgagtacatcgtggggagagtgtgggtgggtgtg
tggctcatcatcattgtggtggtgattgtggcagtggaaggaagctttttggtgcgcttc
atctcccgcttcactcaggagatcttctccatcctcatctccttcattttcatctacgag
accttctctaaactcggcaagattttcaaggcgcatcctctcatcctcaactatgatcac
ctgaacaacacagtggaggacccatggcacccagtcgccaaaaccattgtagataattca
acaggcaacgtgaccattaggactgtcatccacgaacgcgcctatcccaacaccgccctg
ctctccatgtgtctgatgttcggctgcttcgccatcgcttactacctgcgcatcttcaag
aatggctacttcctgcctggcaagctccgtcgcctgatgggcgattttggcgtccccatc
gctatcttcctcatggtcgcagtggacatcaaccttgaggacacctacacccagaaactg
gtggtgcctaagggcctgcaggtgtccaaccctgcaatgcgggggtggctcatcaacccc
atgggcgaacacaagtccttccctgtctggatgatgttcgcctgtgtcgtgcctgcagta
ctggtctttatcctcatcttcctggagtcgcaaatcaccacgctaatagttagtaaacca
gagaggaaaatggcaaaagggtctggcttccattttgaccttctgattttggtcagcttg
gggggatgtgctgcattatttgggatgccttggctcagcgcggctacggtccggtcggta
actcatgccaatgcactgactgtgatgagcaaagggcccaagccggagattgagaaagtt
ctggagcagagggtcagtggcgtgttggtcgccctgttagtaggcctctccatcctcatg
gaacctatcctaaagatgattcccatggcagctctgtttggaatcttcctctacatgggg
atcacatctctcagcgggattcagctgtgggatcgctttctgctcctcctagttcccaaa
aagtaccatcccaatgaaccatacgctacaaaagtaaagacgaacaggatgcacttgtac
acagccattcagctggtgtgcctggccgtcttgtggattgtgaagtccagtcctttctcc
ctggccctgcccttcatcctcatcctcaccatccctctgcgcatggtcatgactggccgc
atcttcactgaatttgagatgaaatgcctggatgctgatgatgccaaagtgacatttgag
gaagaacctggagtggatatgtactcagagacacggatgccttcgtag

DBGET integrated database retrieval system