KEGG   Astyanax mexicanus (Mexican tetra): 103026761Help
Entry
103026761         CDS       T05042                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00561  Glycerolipid metabolism
amex01100  Metabolic pathways
Module
amex_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    103026761 (mgll)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103026761 (mgll)
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S33
   103026761 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DLH Esterase Lipase_3 Peptidase_S9 Thioesterase Abhydrolase_2 LIDHydrolase PGAP1 Peptidase_S15 Abhydrolase_5 Abhydrolase_3 DUF1057 DUF1350 OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 103026761
NCBI-ProteinID: XP_022521824
Position
Unknown
AA seq 302 aa AA seqDB search
MPEEEAGGGSWSPQGVPYRDLPHIVSADGLHLFCRYWEPEAPPRALVFIAHGAGEHCGMY
TDVAHTLVQKGLYVFAHDHVGHGQSEGERMNIKNFQIYIRDALQHIDLIRARHPSLPVFI
LGHSMGGAISILAACERPQDFVGVVLIGPLIQMNPESATPFKVFLAKVLSHMIPSLTLGA
IDPKSVSRDPKQVEAYEADELNYHGGMRVSFGMQLMTAANRIERELPNITWPFYILHGDA
DKLCDIGGSHLMFNQAKSTDKKLKVYEGAYHALHHDLPETAESVLQEVSSWIVERLPAPS
GP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggaggaggcggggggcggctcgtggagcccgcagggggttccgtaccgcgac
ctgccgcacatcgtctccgccgacgggctgcacctgttctgccgctactgggagccggag
gctccgcccagggccctggtgtttattgcacatggagctggggaacactgtggaatgtac
actgacgtcgctcacacactcgtgcagaagggcctgtacgtgttcgcccacgaccacgtg
gggcacgggcagagtgaaggagagaggatgaatattaaaaacttccagatttatatcaga
gacgctctgcagcacatcgacctcatcagagcgcgtcaccccagcctccccgtcttcatc
ctcggacactccatgggtggtgctatctccattctggcagcgtgtgagaggccgcaggat
tttgtgggtgtggttctgatcggcccattgatccagatgaaccctgagtctgctacacct
tttaaggtgttcctggcgaaagtcctcagccatatgattcccagtctcactctcggagcc
atcgacccaaaatccgtctcacgggaccccaaacaggtggaagcgtatgaagcagatgag
ctgaattatcacggagggatgcgcgtgtcgttcggtatgcagctcatgaccgcagccaat
cgtatcgagagagagctgcccaacatcacctggcctttctacatcctgcacggagacgct
gacaagctgtgcgacatcggaggatctcacctgatgttcaaccaggctaagagcaccgat
aaaaaactcaaggtgtatgaaggagcataccacgccctccaccacgacctgccggagacg
gccgagtccgtcctacaggaagtgagcagctggatcgtggagcgtcttcccgccccctct
ggaccctag

DBGET integrated database retrieval system