KEGG   Astyanax mexicanus (Mexican tetra): 103026892Help
Entry
103026892         CDS       T05042                                 

Definition
(RefSeq) 60 kDa lysophospholipase-like
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103026892
Enzymes [BR:amex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     103026892
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     103026892
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     103026892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase Asparaginase_C DCX ThuA
Motif
Other DBs
NCBI-GeneID: 103026892
NCBI-ProteinID: XP_022519916
Ensembl: ENSAMXG00000007011
Position
Unknown
AA seq 353 aa AA seqDB search
MALERKVYVLYTGGTFGMKKDKDGKLVPQPLETIERFFIHHTVLYERKPEETEEDVIKRI
RTPNGFNILYHQLADDYPTPPPEGKQYKILYKFESMPTPIDSSNVTPKDWSDMAEKIQNN
MEAYNGFVVIHGTDTMAYTSSALSFILGEIKKPVIVTGAQMPIFHPRTDGVDNFVGSMLM
AAYFCDTPSLQQVMLYDMNKLFQGNRVEKFDCDSFSVFDSPDVYPLASLETTIKLITSKI
ELKKVDTKTTCTVKKMFTLDGIPQVKILRFFPGITEDYVCCVLNGAAGVILETYGTGNIP
ERDWLLKLLMDADKRKVLMLNCTQVYRGTVLPIYGSSGILQKANVIPGYDITA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggctttagaaagaaaggtgtatgtgctctacaccggaggaacatttggcatgaaaaaa
gacaaggatggtaaacttgttccacagcctctggaaacaatcgaaaggttcttcatacat
cacactgtcctttatgagaggaaacctgaagaaactgaggaagatgtcataaaacgcatc
cgcaccccaaacggcttcaacatactatatcaccagttggctgatgattaccccacacct
cccccagaaggaaaacagtacaaaatcctttataagtttgaaagcatgccgacgccgatt
gactcctcaaatgtgacccctaaagactggagtgacatggctgaaaagattcagaacaac
atggaagcgtataatggatttgttgttatccacggcacagacacaatggcctacacctcc
tccgctctgtccttcattttgggggagattaagaagcctgtgattgttactggagcacag
atgcccatcttccatcctcgcactgatggtgtggataattttgttggttcgatgctgatg
gcggcatacttttgtgacacaccgagtctgcagcaggtgatgctttatgatatgaacaaa
ctgtttcaagggaaccgagtggagaagtttgactgtgattcttttagtgtgtttgacagt
cctgatgtgtatcctctggctagtctggaaaccacaatcaagttgattacttcaaaaatt
gaactgaaaaaagtggacaccaaaaccacctgcactgtgaagaaaatgttcacattggat
ggcatcccacaggtgaagatcctgagatttttccctgggataacagaagattatgtttgt
tgtgttctgaatggagctgctggagtcatcctggaaacttatggcactggaaatattcca
gaacgtgattggctcttgaagctcctgatggatgcagataagaggaaggttctgatgttg
aactgtactcaggtgtaccggggcactgtcttacccatctatggttcctctgggatacta
caaaaagcaaacgttattcctggctatgacatcactgcctga

DBGET integrated database retrieval system