KEGG   Astyanax mexicanus (Mexican tetra): 103026934
Entry
103026934         CDS       T05042                                 

Definition
(RefSeq) uncharacterized protein LOC103026934
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103026934
Transcription factors [BR:amex03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103026934
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 103026934
NCBI-ProteinID: XP_022523943
Ensembl: ENSAMXG00000015160
Position
3
AA seq 588 aa
MIPPGDCMYAGRKRRKPIQKQKPAPVTEKSNPSKRHRDRLNAELDRLASLLPFSPEIISK
LDKLSVLRLSVSYLRVKSFFHASQEKLSRRHVSSSSVQEVRKESASPKPCVPESELLLES
LAGFALVVSSDGMVFYSSSTIVDYLGFHQTDVMHQNIFDYIHVDDRQEFRQQLHWAMNPS
HQMASDHLQATGTSEDFVVSSLFHSQEASGISPEFSPFLNRCFISRVRCLLDSTSGFLTG
LTLEEHLRRQPVVNEGGDPLYLNCSTPGPRHHTPWSPLSKNSFKYKTEDYYSQEEPLNYC
KSSASGLKVPHVENMWPMRNSCGSVRTGHGVNVLPGGKLGKYSHYGKPYRMSPGYHNNRA
DLCVPKLYGSLPQPGEVDGYYVESIKSENGCYEEQGYDEHLMAELPIKVEQDSDSENGCD
VYGRPWTARERYPSSYDGLQMKAESGYYEQYSPCQRSKGGNGQPYSSHYQNVCSVTARPM
KCVLNKDLEPLSPQKLGHTDPLCSSQSANCMDSYSGGPVEHKGYMQQDYKLGYEFKGQGL
LHSIKREPMDSPPWHDGKHDHMGVQRNIMSNCIMNAGQPKANPYIFMQ
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgatcccaccaggggactgcatgtacgccgggaggaagcggaggaagcccatccagaag
caaaagccggccccggtgacggagaaatccaacccgtcaaaacgacacagagatcgtctg
aacgctgagctggatcggctggccagtctgctgcctttctcccctgaaatcatctccaaa
ctggacaaactgtctgtgctgcgtctcagcgtcagttacctacgcgtcaagagcttcttc
catgccagccaggagaagctgtctcggaggcacgtcagctcctcatccgttcaggaggtc
aggaaggagagtgcctcacccaaaccctgtgtcccagagagtgagctcctgctggagtcc
ctcgctggttttgctctggttgtgagcagtgatgggatggtgttctactcttcatccact
atagtggactatctgggcttccatcagactgatgtgatgcaccagaacatctttgactac
atccatgtagatgacagacaggagttcaggcagcagctccactgggccatgaacccttca
catcagatggcgtctgatcacctccaggccacgggaaccagtgaagatttcgtggtcagc
agcttattccactctcaggaggcgagtggcatttctccagagttctctcccttccttaat
cgctgcttcatctcaagagtgcgttgcctactggacagcacctcaggattccttactgga
ttgacactagaggagcacttacgacgacagccagtggtgaatgaaggtggagacccactt
tacctgaactgttccactcctggaccacgccaccataccccctggtcacctctctccaaa
aacagcttcaaatacaaaactgaggactactacagccaggaggagcctctcaactactgc
aagtcctctgctagtggacttaaagtccctcacgtggaaaacatgtggcccatgagaaac
tcctgtgggtctgtccgcacaggtcatggcgtaaacgtgttgcccggtggtaaactaggc
aaatacagtcactatgggaagccctacagaatgtccccaggatatcacaacaacagggca
gacctctgtgttccaaagctttacggaagtcttccacagcctggagaagtggacgggtat
tatgtggagagcatcaagagcgaaaatggctgttatgaagaacaaggctatgacgaacat
ctaatggcggagttgccgattaaggtagaacaggactcagactctgaaaatggctgtgat
gtctatggcaggccttggacagccagagaacgttacccaagctcttacgatggtctccag
atgaaagcagagagcggctactatgaacagtactcgccctgccagaggagcaaggggggt
aacggacagccgtacagcagccactatcagaacgtctgcagtgtgactgcacgaccaatg
aagtgtgtcctcaataaagatctagagcctctcagcccccagaaactgggacacacagac
cccctctgcagtagtcagagtgctaactgcatggacagctacagtggtgggcccgtagag
cacaagggctacatgcagcaggattacaaacttggctatgagttcaaaggacaaggactg
cttcactccatcaagcgcgagcccatggactctccaccctggcatgatggcaaacatgat
cacatgggagtgcagaggaatatcatgtcaaattgcataatgaatgctgggcagcccaaa
gctaatccatatatctttatgcaatag

DBGET integrated database retrieval system