KEGG   Astyanax mexicanus (Mexican tetra): 103026988Help
Entry
103026988         CDS       T05042                                 

Gene name
st3gal3
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00514  Other types of O-glycan biosynthesis
amex00515  Mannose type O-glycan biosynthesis
amex00533  Glycosaminoglycan biosynthesis - keratan sulfate
amex00601  Glycosphingolipid biosynthesis - lacto and neolacto series
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    103026988 (st3gal3)
   00514 Other types of O-glycan biosynthesis
    103026988 (st3gal3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    103026988 (st3gal3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103026988 (st3gal3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:amex01003]
    103026988 (st3gal3)
Enzymes [BR:amex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     103026988 (st3gal3)
Glycosyltransferases [BR:amex01003]
 Terminal extension
  Sialyltransferase
   103026988 (st3gal3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 103026988
NCBI-ProteinID: XP_007244218
Ensembl: ENSAMXG00000012816
Position
13
AA seq 373 aa AA seqDB search
MRAMKPTRNLMLVLCPTLVLGFLYYSSGRLHLQVWGQKSQVDADNSVFVGHVAVYDKQGF
LLKLDVKLPLELQYKYGNLSKGECRPGYSEAKMTSIYPKFARPAPMFLDPNFKRLSKIGS
FSPPFGIKTQEKIIDIILAETKNYGLGPELDSLSCKRCIIVGNGGILSNKSLGSKIDEYD
VVVRLNEAPVSGFEKDVGSKTTMRITYPEGAIQKIERYEKSSLFVISAFKPPDIKWFRQM
VFKERLRGTEGFWKSVARSVPREPEHMRILNPFFIQEAAFRFIGLPHNNGLMGRGNIPTL
GTVAITMALHNCDEVAVAGFGYDMSTPHAPLHYYEKLRMSAIKESWTHNIAKEKEFLRKL
VMAGVIHDLTNGI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatgaagcccacaaggaacctgatgctggtgctttgtcccacactggtgctg
ggcttcctttactactcatctggcagactgcatctgcaggtctgggggcaaaaatcacaa
gtggacgcagataactcagtcttcgtgggacatgtagcagtgtatgacaagcagggattc
ctcctcaagcttgatgtaaaactgccactggagctgcagtataagtacggcaacctgagt
aaaggagagtgcaggcctggctactcagaggccaagatgacctcaatctatccaaaattt
gccagaccagctcctatgttcctcgacccaaattttaaacgtctatcaaagataggcagt
ttttcacctcccttcggcataaaaacccaagaaaagatcattgatattattttagccgag
acaaagaactacgggctgggacctgaactggacagtttgagttgtaaaagatgcatcatc
gtcgggaacgggggcatcctctccaacaaatccttgggctccaaaattgatgagtatgat
gtggtcgtaaggctgaatgaggctccagtaagtggctttgagaaagatgtgggctccaag
actaccatgcgcatcacctacccagagggggcgatccagaagattgaacgctatgaaaaa
tcctccctgttcgtcatctctgccttcaaacctccagatatcaaatggttcagacagatg
gtgttcaaggagagactccgcggaacggaggggttctggaagtcggtggcgcggagtgtg
ccgagggagccggaacacatgcggattctgaaccccttcttcatccaggaggcagcgttc
agattcatcggcctgccgcacaacaatggcctcatgggtcgagggaacattccgacactg
gggacagtggcgattacgatggctctgcataactgtgatgaagtggcggtggctggcttt
gggtatgacatgagcacaccccacgctccgctgcattactacgagaagctcaggatgtct
gctattaaagagtcatggacacacaacatagcaaaagagaaggagtttttgcgaaagctg
gtgatggctggggtcatacacgatttgaccaacgggatatga

DBGET integrated database retrieval system