KEGG   Astyanax mexicanus (Mexican tetra): 103027191Help
Entry
103027191         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde dehydrogenase, dimeric NADP-preferring
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00010  Glycolysis / Gluconeogenesis
amex00053  Ascorbate and aldarate metabolism
amex00071  Fatty acid degradation
amex00280  Valine, leucine and isoleucine degradation
amex00310  Lysine degradation
amex00330  Arginine and proline metabolism
amex00340  Histidine metabolism
amex00380  Tryptophan metabolism
amex00410  beta-Alanine metabolism
amex00561  Glycerolipid metabolism
amex00620  Pyruvate metabolism
amex01100  Metabolic pathways
Module
amex_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103027191
   00053 Ascorbate and aldarate metabolism
    103027191
   00620 Pyruvate metabolism
    103027191
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103027191
   00561 Glycerolipid metabolism
    103027191
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103027191
   00310 Lysine degradation
    103027191
   00330 Arginine and proline metabolism
    103027191
   00340 Histidine metabolism
    103027191
   00380 Tryptophan metabolism
    103027191
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103027191
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103027191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103027191
NCBI-ProteinID: XP_022524625
Ensembl: ENSAMXG00000009212
Position
1
AA seq 495 aa AA seqDB search
MEKLAVDEAQKAFSSGRSRPLQYRKQQLRALLRLITEHQADIAAALKQDLNRSEFDTPLF
ELIGLEHEIKVAEXELSDWASPQPARKSLVTINDDVYIQAEPLGVVLIIGAWNYPWALTL
QPLIGAIAAGNAAVVKPSELSQNSSSLLKQLLPHYLDKEMYPVVTGGVPETQELLRQRFD
HIFYTGNSTVGKLIMEAAARHLTPVTLELGGKSPCYIDKNCDIAVACRRITWGKFANCGQ
TCIAPDYILCHPSIQNKVIEELRLTLLEFYGEEPQTSPDYGRIINQRHFERVLTLMEGCT
VAVGGGSDKTQCYIAPTILRDVLPHARIMQEEIFGPVLPIISISDVSEAIHFINEREKPL
ALYVFSSDKKVIKRMLNETTSGGVVVNDVMMHYTVTSLPFGGVGNSGMGRYHGKHTFDQL
SHHRACLIKSLAMESLNKARYPPLTPSRLRRAKFFMTSRLCTCAQATCAWAVIATMLALG
LLIALLIVLLKDPVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctggcagtggatgaagctcaaaaagccttcagttctgggaggtcgagaccc
ttacagtacagaaaacagcagctcagagctctgctcagactgatcacagagcaccaagca
gacatcgcagcagctctcaaacaggaccttaacaggagtgagtttgatacaccacttttt
gagctgattggactggagcatgaaatcaaggtggctgaanaagagctcagtgactgggcg
agtcctcagcctgcaagaaagagcctggttaccataaacgatgatgtttacattcaagct
gagcctttgggtgttgtgctgatcattggagcctggaactatccctgggctctgacatta
cagccgcttataggagccatagcagcaggtaatgctgctgtggtgaagccctctgaactg
agccagaactcgtccagtctactaaaacaactgcttcctcattatttggataaggagatg
taccctgttgtgactggaggagttccagagacccaggagcttctgaggcagcgctttgac
cacatcttctatacgggaaacagcacagtgggcaaactgattatggaagctgctgcacga
catctcacaccagtgactctggagctgggaggaaaaagtccctgttacattgataagaac
tgtgacatagcagttgcttgccgtcgaattacctgggggaaatttgctaactgtggccag
acgtgcatcgcaccagactacattctttgtcatcctagtatccagaacaaagtcattgag
gagttacggctcacgttactggagttttatggtgaggagccccaaacttctcctgattac
ggccgcattatcaaccagcgccactttgagcgagttttgaccttgatggagggatgcact
gtggctgttgggggaggaagtgataaaacccagtgttatattgcacctactattctaagg
gatgtcttgccccatgccaggataatgcaagaggagatctttggacctgtgctaccgata
ataagtatcagtgatgtcagtgaagctattcactttatcaacgagagggagaaaccactg
gctctttatgttttttcttctgataagaaggtgattaagcgaatgctgaacgagacaacg
agtggaggggtcgtggttaatgatgtcatgatgcattatacagtcacctcgttgcctttt
gggggtgtagggaacagtggaatgggcagatatcatggaaagcacacctttgaccagtta
agtcaccaccgtgcttgtcttatcaagtcattggcgatggaaagtctaaataaagcccgc
taccctcccctgactccgtcccgcctgcgtagggccaagttcttcatgacgagccgcttg
tgcacctgcgcccaggctacctgtgcctgggccgtcatcgctaccatgcttgcactgggt
ctcctgattgccttactgatagttcttctcaaggatccggtggcctga

DBGET integrated database retrieval system