KEGG   Astyanax mexicanus (Mexican tetra): 103027441Help
Entry
103027441         CDS       T05042                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04060  Cytokine-cytokine receptor interaction
amex04068  FoxO signaling pathway
amex04210  Apoptosis
amex04217  Necroptosis
amex05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103027441
   04068 FoxO signaling pathway
    103027441
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103027441
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103027441
   04217 Necroptosis
    103027441
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103027441
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amex04147]
    103027441
   04052 Cytokines and growth factors [BR:amex04052]
    103027441
   04090 CD molecules [BR:amex04090]
    103027441
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103027441
Cytokines and growth factors [BR:amex04052]
 Cytokines
  Tumor necrosis fators
   103027441
CD molecules [BR:amex04090]
 Proteins
  103027441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 103027441
NCBI-ProteinID: XP_007259540
Ensembl: ENSAMXG00000005055
Position
3
AA seq 266 aa AA seqDB search
MNGNLRYQYPPVFTVDAAGGLHQQHHHHHPQMAAARTDPTLVPCWTFPPARAQTKRRSCG
GLTSAAGTLLVMVLVVIFAALGLGAYQIRKLEMEVIKLKKEMNKPTESMAPQKLVGNQVE
ANEKANHIEAAHLMGKMQRTDTLKWEAKHGRAFTKGIQYRDGSLLVNKTGLYFVYSRVEF
LSNNCKQRDSLVHEVYVKSNGENQKLMGDRREGFCQAGSTEVWTSGSNLGSIQELKQGDL
VFVSVSHPERLSHEYYDNYFGIFSLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtaacctaaggtaccagtatccaccagtgttcacagtggatgctgcaggaggc
cttcatcagcagcatcatcatcatcatccccagatggctgctgcaaggacagatccgacc
ctggttccctgctggacctttccccctgctcgtgcccagaccaagaggaggagctgtgga
ggactgacctctgctgcaggaaccctcctggttatggtgctggtggtgatctttgctgca
ctgggactgggagcctaccaaattaggaaactcgaaatggaggtgataaagctcaagaag
gaaatgaacaaaccaactgaaagcatggcaccgcagaagctggttggaaaccaagtagaa
gcaaatgaaaaggccaatcatattgaagctgcacatctgatgggaaaaatgcaaagaaca
gacaccttgaagtgggaagccaagcatggccgtgcttttacaaagggcatccagtaccga
gacggcagtctactggtgaacaagacgggcctctactttgtctactcgcgtgtagaattc
ctttcaaataactgcaaacagagggactccttggtccatgaggtgtatgtgaagagtaat
ggtgaaaatcaaaagctcatgggtgatcgcagagaaggtttctgccaggctgggagcaca
gaggtgtggacgtctggaagcaatcttggctccatccaagagctcaagcagggtgacttg
gtgtttgtttctgtgtcccatccggaacggcttagccatgaatactacgataattacttt
ggtatcttcagcctctcctga

DBGET integrated database retrieval system