KEGG   Astyanax mexicanus (Mexican tetra): 103027772
Entry
103027772         CDS       T05042                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00100  Steroid biosynthesis
amex01100  Metabolic pathways
Module
amex_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103027772 (tm7sf2)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103027772 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 ICMT DUF1295 PEMT
Other DBs
NCBI-GeneID: 103027772
NCBI-ProteinID: XP_007239164
Position
Unknown
AA seq 421 aa
MKLNKHKPAQLTEMEFGGILGATCIPVFLPLTVLYLLSVCRTPSGALLQWPPPLPHPAFL
WDPLAAVIITGWIGLQSALYQFPVGRVSEGLALRDGTRLKYQINGFHALCMTAMLLGLCV
SLGMPLGYLFDLILPLAVCAICVSYLLALYLYIGSFWAPAHALALGGNTGNPLYDFFIGR
ELNPRIGSFDLKFFCELRPGLIGWVVLNMAMMMKEVELRDSPSLAMLLVNGFQLLYVMDA
LWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYGLQAMFLVVHPRSLSPPTVIGIILLN
GLGYYIFRKSNSQKNQFRRDPNHRSVAHLETIATATGKRLLVSGWWGFVRHPNYLGDILM
ALAWSLPCGFSHILPYFYVIYFSILLVHREARDERQCRAKYGIAWDNYCRRVPYRIIPYI
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaagctgaacaaacacaaaccagctcaactcacagagatggagtttgggggtattttg
ggtgcaacctgtatccccgtgttcctccctctgacggttctgtatctgctgagtgtgtgt
cggactccaagtggtgctctgctgcaatggcccccgcctctgccccaccctgctttcttg
tgggaccctttagctgctgttatcatcactggctggatcggcctacagagtgccctatac
cagtttcctgtggggagggtatcagaaggactggcattgagagatggaaccagactgaaa
tatcagatcaatggcttccacgccctctgtatgacggccatgctgctgggtctgtgtgtg
agtttgggtatgccactgggttacctgttcgatctgattttgccgttggcagtgtgtgcg
atctgtgtttcatacctacttgccctctacttgtacatcggctccttctgggcacctgca
catgctctcgcacttggaggaaacacagggaaccctctgtatgatttcttcattggccgg
gagctgaaccctcgaattggctcttttgacctgaaattcttctgtgagctgcggcctgga
ttaataggctgggtggtgctcaacatggcaatgatgatgaaggaggtggagctcagagat
tctccatctctggctatgttgctggtcaatgggttccagctgctttatgtgatggatgct
ctgtggaatgaggaggctgtgctgaccaccatggacatcgtgcatgatgggtttgggttc
atgctggcatttggggatttagcatgggttccgtttacatatggccttcaggccatgttt
ctggttgtgcatccccggtctctcagtccgcccactgtgatcgggatcatactgctgaac
ggacttggatattatatcttccgtaaatccaattcgcagaaaaaccagtttaggagagac
ccaaatcacagaagtgttgcacatctagagactattgccactgccacaggaaagcgtctg
ttagtgtccggttggtggggtttcgtaagacacccgaactatcttggggacatcctcatg
gcattggcctggtccctgccctgtggtttttcccacattcttccatatttctacgtaatt
tatttctccatcctgctggtccatcgggaagcgcgagatgaacgacaatgcagagccaaa
tatggcatagcctgggacaactactgtagacgggttccttacagaatcataccctacatc
tactga

DBGET integrated database retrieval system