KEGG   Astyanax mexicanus (Mexican tetra): 103028342Help
Entry
103028342         CDS       T05042                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amex01002]
    103028342
Enzymes [BR:amex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103028342
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S33
   103028342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Thioesterase Ndr
Motif
Other DBs
NCBI-GeneID: 103028342
NCBI-ProteinID: XP_022533125
Position
15
AA seq 339 aa AA seqDB search
MDLDVLNLFAIAMGTLAVPILLFMASFMLWPSSLIKVYYWYWRRTLGLQVCYAECGGYRF
CYSYRGKPGFRPSILMLHDFSAHKDTWLSMVKYLPKHLHLLCVDMPGHEGTTRTNVEDYS
IQGQVKRIRQFVETVHLNRKPFHLVGMSMGGNVAGVYAACYPSDLCSMTLICPAGLRYPC
KTKFDDQMHELEISEYTLSIPLIPSTPEEMEDMLKLCSHVRFRVPQQILQGLVDVRIPHN
DFYHEVFMEIMGENSKYALHEHLHLITTPLQVIWGKQDQVVDVSGAGVLAEAVPGCRVDL
LENCGHSVVMERPKRTAKLVLDFIISHQSAASANSKKKF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatctggatgtgctgaacttatttgccattgctatggggaccctggctgttcccatt
ctgctcttcatggcatcttttatgctgtggccttcatctctcatcaaagtgtattactgg
tactggaggcgaaccctgggcctgcaggtgtgctatgcggaatgtggaggatatcgtttc
tgttactcttacagaggaaagccaggcttcaggccctcaattctcatgcttcatgacttc
tccgcacacaaagacacatggctctctatggttaagtaccttcccaaacatctgcacctc
ctgtgtgtggacatgccaggacatgagggcacaacacgcaccaacgtagaagactactct
atccagggccaggttaagagaataagacagtttgtagagactgttcatctcaacaggaag
ccattccacttggtgggcatgtcaatgggtggaaacgttgcaggagtgtatgcagcctgc
tacccctcagacctctgcagtatgacgctcatctgtccagctggtctaaggtacccttgc
aagaccaagtttgatgaccaaatgcatgagctggagatcagtgaatacacgctgagcatt
cctttaatcccatcaaccccagaggaaatggaggacatgctaaagctctgctcacatgta
cgctttagagtccctcaacagattcttcagggactggtggatgtacgaattccacacaat
gacttttatcatgaagtattcatggagattatgggggagaactctaaatatgccttgcat
gaacatctgcacctgatcaccactcctttacaagtcatctggggaaagcaggaccaggta
gtggacgtttctggggcaggtgtgctggctgaggctgtgccaggctgccgtgtggacctg
ctggagaactgcggtcattctgtagtgatggagcggccaaagcgcacagccaagctcgtc
ttagactttatcatctctcatcagagtgcagcgagtgccaacagcaaaaagaaattctga

DBGET integrated database retrieval system