KEGG   Astyanax mexicanus (Mexican tetra): 103029689
Entry
103029689         CDS       T05042                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00230  Purine metabolism
amex00240  Pyrimidine metabolism
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103029689
   00240 Pyrimidine metabolism
    103029689
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103029689
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 103029689
NCBI-ProteinID: XP_007244593
Ensembl: ENSAMXG00000007386
UniProt: A0A3B1IEL4
Position
14
AA seq 264 aa
MATPPKRICRSPVFNNSFEKRVKKISIEGNIAAGKSTFVRLLERESDEWEVIPEPIGKWC
NVQTTDNEYEELSTSQKSGGNLLQMLYDKPSRWSYTFQSYACLSRVRSQLQPPSAKLQLA
EKPVQFFERSVYSDRYVFASNLFESGDLNETEFAIYQDWHSWLLSQFESEIELDAMIYLR
ADPERCMQRLKFRGREEELGIPLEYLEKLHYKHECWLYNRTTQLDFEYLKDIPILVLDVN
EDFKNDRIKQQGVIDKVNEFLSTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggccactcctcctaagagaatatgccggagccccgtctttaacaacagctttgagaaa
agagtaaagaagatctctatcgagggaaacattgctgcaggtaaatccacctttgtgagg
ctgctggaaagagaatcagatgagtgggaagttataccggaacccattgggaagtggtgc
aatgttcagacaacagataatgaatatgaggagctgagcacatcccagaagagtggaggc
aacctgctgcagatgttgtatgacaagcccagccgctggtcctacactttccagagctat
gcttgtctaagtcgtgttcgttcccagcttcagcctccctctgccaagctgcagctcgca
gagaaaccagtccagttctttgagcgctccgtctacagtgacagatatgtctttgcttca
aatctctttgagtctggagatctgaatgagactgagtttgccatttatcaggactggcac
agctggctcctctctcaatttgagtctgagattgagcttgatgcaatgatctacctgagg
gcagatcctgagagatgtatgcagcgtcttaaatttagaggaagagaagaagaactgggc
attcctcttgagtacttggagaaacttcattataagcatgaatgctggctctacaacaga
acaacacagctggattttgagtacctgaaggatatccccattctggtgctggatgttaac
gaagatttcaaaaatgacagaattaagcagcaaggagtgatcgacaaggtgaatgaattc
ctgagtacgctgtga

DBGET integrated database retrieval system