KEGG   Astyanax mexicanus (Mexican tetra): 103029987
Entry
103029987         CDS       T05042                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amex01002]
    103029987 (adamts13)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     103029987 (adamts13)
Peptidases and inhibitors [BR:amex01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   103029987 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 Reprolysin_5 TSP1_spondin ADAM_spacer1 TSP1_CCN Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 103029987
NCBI-ProteinID: XP_022519294
Ensembl: ENSAMXG00000001276 ENSAMXG00000019550
Position
Unknown
AA seq 1550 aa
MAGLVSLFLASVLVDTVLLTSEFSLEKDFLQSLQHQDLLYYFNTNSMTSVPDLQLVWVNC
SSRRPWQCSFQAQGEQFQLGQLTKDQLFFCPSSLEFTVNSTLSIIKRRENTCCERLYLQK
PENTQTLLSVCHGKLQGLLLFQPGKRKMSIQPLLQKHSDHLRNSVDHIAGVPHLMLTHPS
PVVKTHLKQSQSHHRIQRSFLGTEVSHLELLVVVGPDVHDVHKQDTERYILTNLNIASEL
LRDVTLGANMRVHLVRMIILTEAEPEIQISDNITSSLRSVCEWGHKVNPSNDTDPLHADL
LLYITRFDLVLPSGNKLVRGVTQLGGVCSSQWNCVITEDTGFDLGITIAHEIGHSFGINH
DSIANTCSGSGFIMASDGGYNSVDLTWSQCSRSQLLDFYSAGKAECVKDVPVVGGSQQQW
RPGLYYGVDDQCRIAFGRTATACSFNSNDMATCRVLSCHIIPGDRSSCTRLLVPLLDGTE
CGPNQWCLKGRCVSPSKLSSSMVVHGSWSSWYDFSPCSRTCGGGITFRKRECNNPRPAFG
GRECEGDGIEAELCHRQSCESTQFEFMAQQCSDTDHQPLLVSPHSDTVYSWIPAVGFSSG
DAQCKLVCRSREQEFMVSRGSQFIDGTRCEPDDPVPTGMVTACLRGKCQEFGCDGVLHSR
KVEDLCGVCGGNSSTCQLISGSYTGGEAQEYVTFLILPVNASQVHVINWKPVFTHLAVLV
NGEYIVSGHGDIALNTTHPSPLEESHMIYRLYLTADLLPQTEELTLSGPIRDKIHIQVYR
KYGKEYGDVTSPNITYQYYMRDNIPMKKGAEGQWSTIISPCSVTCGTGIQKVTQECVDMN
TQEHLEEQLCGSSPPSPTRLQPCYLPDCPASWVLGEFGPCSTPCGSGEWVRSVACLQKQG
TETVTLPDSECSQIKPPVTETCNTHLCPARWQVSEPGECSAVCGPGEAPRTVLCVRNHRG
ADVEVDDSLCPLPKPSEHVTCVVDVCPIGWETQKQNHGSGSLSLMPRSRMKPVYVWSPVI
GHCTKTCGNGTQQIWFSCVDHQSRLDVPEFLCDRFSKPELYTQPCAQSPCPVMWRYMQGE
CSVSCGGGVARRVLYCSQQETEAMEVLLADSACLHVPRPLEVVVCNTEACPTRWQAGEQG
SCSVSCGLGVALRRVWCSQFNGGVETEVEEERCDVGKKPPLEVPCFPQACSFHWAMQEWS
ECSVSCGGYGIQSRTVSCRGPSSPLPVSPILCVHLPKPITIQACFSSDCSTPVSPTQELS
TVPTQAPVIRSRHRAWKIDLGKKRKPTTAAGTAISKLTSEVLPTVPVLESTTLPTQPAQL
TQSSICGQLFLQDSGTIDLQNVTERRCFIAIGRPLDEVIQIKIESSSLNCRHRENLALYE
RLSLRRFCEKMTGKLVTSRSNVLLVRQSRISPGNGVLLSFRSEKNPKKTHHEDCDVQLFS
PSGLIENPVRNSSSSTFSSQSCRVFIDAPPALRINIRALSVFNTSSSDSTYVLMRDVDAV
KTTVFKGTQLFQWSSTGSRAEVEFHGEYQHKKGTFRAEYSYVKPEEAKLI
NT seq 4653 nt   +upstreamnt  +downstreamnt
atggcagggcttgtgtctctctttctagcttcagtcctggtggacacagttctgttgaca
tctgagttttccctggaaaaggactttttacagtcacttcaacatcaagatctgttatat
tactttaatacaaattcaatgacatcagtgcctgatctgcagctggtgtgggtaaactgc
tccagcagaaggccctggcagtgctcttttcaagcccagggtgaacagtttcagctgggc
cagctaaccaaggatcagctgtttttctgtccctctagcctggagttcactgttaattca
acactcagtataataaagagaagggaaaatacctgttgtgagcgactttacctgcagaaa
ccagaaaacactcaaactcttctctctgtgtgccacggaaagcttcaaggcctacttcta
ttccagccaggaaagagaaagatgtccatacagcctttgctccaaaaacattcagaccac
ttaagaaacagtgtggaccacatcgcaggagtgccacatctgatgctgacccatccctca
cctgtggtgaagacacacctcaaacagtcacagagtcatcatcgcatacagaggtcattt
ctgggaacagaagtgagtcatttagaactgctggtggtggtcggtcctgacgtccatgat
gttcacaagcaggacactgagagatacatcctcaccaacctgaatattgcttcagagttg
ttgagagacgtcactctgggggcaaacatgagagttcatctggtccgtatgattattctc
actgaggcagagccagagattcagatttctgacaacatcacctcttctctaagaagtgtg
tgcgaatggggtcataaggtcaacccctccaatgacactgaccctctgcatgcggacttg
ctcctgtatatcaccaggtttgacctggtgctgcccagtgggaataaactagtgagaggt
gtgacgcagctgggcggagtctgttccagccaatggaattgtgtcattacagaagataca
ggctttgatctgggaatcacaatagcacacgagatcggacacagttttggcataaaccac
gatagtatagctaacacatgcagtgggagtgggtttataatggcatctgatggcggttac
aacagtgtggatctcacctggtcccagtgcagcagaagccagcttcttgatttctacagt
gcaggcaaggcagagtgtgtgaaggatgttccggtggtgggaggttctcaacagcagtgg
aggcctgggctgtattatggggtggacgatcaatgtcgcattgcgtttggaagaacagcc
actgcctgctcttttaatagcaatgacatggccacatgtcgggttctgtcctgccacatc
atccctggtgatcgcagctcctgtacccgactacttgtgccactgctggatggtactgaa
tgtggtccaaaccagtggtgtttgaaaggccgctgtgtatctccatccaagctgagctct
tctatggtagttcatggctcctggtcgtcttggtatgatttttccccctgttcacgtacc
tgtggagggggcatcacatttcgcaagagagagtgtaacaaccccaggccagcgtttggg
gggagagagtgtgagggagatggcatagaagctgaactttgtcaccgccagtcgtgtgag
agtacccagtttgagtttatggcccagcagtgctcagatacagatcatcagcctctcttg
gtgtctccacattcagacacagtctactcctggatacctgcagttggtttcagctcaggt
gatgctcagtgtaagcttgtatgtcggtctcgtgagcaggagttcatggtgagtcgaggt
tctcagtttatcgatgggacgcggtgtgaaccagatgaccctgtacctaccggcatggtc
actgcctgccttaggggaaagtgccaggagtttggttgtgatggggtgttgcattctagg
aaagtggaagacctgtgtggagtatgtggaggaaatagctccacctgccagttaatctct
ggctcctacacaggtggagaggcacaagagtatgtgaccttccttattctgccagtgaat
gcctcacaagtacatgtgattaactggaagccagttttcacacatctggcggtgctggtg
aacggagaatatattgtttctggacatggagacatagcgttaaacaccacccacccctcc
cctctggaggagagtcatatgatttatcgtctttacctcacagctgaccttttaccacag
acagaggagctaactctgtctggacctatcagagacaaaatccacatacaggtatatcgg
aaatatggaaaggaatatggagatgtcacaagtccaaacatcacataccaatactacatg
cgtgataatatcccgatgaagaagggcgctgagggccagtggtccaccatcatttcaccc
tgctctgttacgtgtggcacaggaattcagaaggtcactcaggagtgtgttgacatgaac
acccaggaacatttagaggagcagctctgtggctcaagtcctccaagcccaactcgtctg
cagccctgctatttacctgactgcccagccagctgggtgcttggtgagtttggtccctgc
agcaccccctgtggttctggagagtgggtgcgctctgtggcctgtctgcagaaacaagga
acagaaacagtcacgctgccggattctgaatgctctcagatcaaacctccagtaactgaa
acctgtaacacccacctgtgccccgccagatggcaagtctcggagcctggtgagtgttct
gctgtgtgtggcccaggtgaggctcccagaactgtgttatgcgtccgaaaccatcgtggt
gctgatgtagaggtggatgacagcctttgccctcttcccaaaccctctgaacacgtgacc
tgcgtggtggatgtctgccctatcggctgggaaacacaaaaacagaaccatggaagtggg
tccctgtctctgatgcctcgttccagaatgaaaccagtgtacgtgtggagccctgtgatt
ggccattgcactaagacctgtgggaatggaacgcagcagatatggttttcctgtgtggat
catcagtcacggctggatgtcccggagttcctgtgtgatcgcttcagcaagcctgaactg
tatactcagccctgtgcccagtcgccatgccctgttatgtggcggtacatgcagggagag
tgcagtgtgtcgtgtggaggtggtgtagccaggagggtgctgtactgctctcaacaggag
acagaagccatggaggtgctgttagctgactctgcctgtctacatgtccccagacccctg
gaggttgtggtgtgtaacactgaggcctgtccaacaaggtggcaagcaggagaacaaggt
tcatgttcagtgtcctgtggtctcggtgtggcactgagaagggtttggtgttcgcagttc
aatggaggggtggagacagaggtggaagaagagaggtgtgatgtaggcaagaagcctccg
ctcgaggtgccctgcttcccccaggcctgctccttccactgggccatgcaggagtggagt
gagtgttctgtctcttgtggtggttacgggatccagtcgaggacagtgtcatgtcgtggc
ccatccagccctctacctgtgagcccaatcctctgtgtccatctgcccaaaccaatcacc
atccaagcctgctttagctctgactgctccacaccagtcagccccacacaggagctcagc
actgttcctacccaggcaccggttatccgcagcaggcacagagcatggaaaatagacctg
ggaaagaagagaaagcctacaactgctgcaggaactgcgatcagcaaactgacctctgaa
gttctaccgacagtgccggttttggaaagcacaacactgccaacacagcctgcacagctg
acacagagcagcatctgtggacagctcttcctccaggactcgggcaccatcgacctacag
aacgttacagagagaaggtgtttcatcgctatcggccgtcctcttgatgaagtcatccaa
atcaaaattgagtccagttctcttaactgcagacacagagagaacctcgctctttatgag
aggctgtctctgaggcgtttctgtgagaagatgacgggaaaattggtaacatctcgttcc
aacgtacttttagtgcgccaaagccgcatcagccctggtaacggggtactgctgtccttc
aggagtgagaagaacccaaagaagacccatcatgaagattgtgacgtccagcttttctct
ccgtctggtctgattgagaatcccgtcagaaattcatcatcctcgactttcagctctcag
tcttgtcgagtgttcatcgatgccccccctgcactgaggataaatatcagagctctgtct
gtgttcaatacgagctcctcagattctacatatgttctgatgcgggatgtggacgctgta
aaaaccacagtctttaaagggacgcagcttttccagtggagttctacaggaagcagagct
gaagtggagttccacggggaataccagcacaagaagggaacgttcagagcagagtattcc
tatgtgaagccagaggaagctaaactcatctaa

DBGET integrated database retrieval system