KEGG   Astyanax mexicanus (Mexican tetra): 103030631Help
Entry
103030631         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amex04131]
    103030631
Membrane trafficking [BR:amex04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103030631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 103030631
NCBI-ProteinID: XP_022522897
Ensembl: ENSAMXG00000013909
Position
Unknown
AA seq 2102 aa AA seqDB search
MAGLANERRAFAHKINRTVAAEVRKQVSREYGSPQLSKKRGGANQQVPLTEVVEPVDYEE
YVSSHAPSPEPGPLRQLMEFPNDDLELLLQERECTTLEPALPEEDTLDPRVRDALGAYTD
DWLIIQRKYQRYSTMQTPHNTERQREKQRGLIKQTFELDEAVAAERQEDQDDSKRRSVSL
DDTPRGSWASSIFDLKNSSPDALLPSLLERTAAEDMDRRNTENRQQGRHPDLLGLYPAPD
EDEAVERCSVPEVPREHTGQRIMVKCLSLKFEIEIEPIFGTLALYDVKEKKKISENFHFD
LNSDQTKGLLRPHTPHTAISTLARSAIFSITYPSPDIFLVIKLEKVLQQGDIGECCEPYM
VMKESDSTKHKEKLEKLKAQAEQYCSRLGRFRMPFAWTAIHLLNIVSSVGGLERSDSDSD
TERKGTWNERKKKGFERMSVGEDMCNFTNFRPATLTVTNFFKQEGDRLSDEDLYKFLADM
RRPSSVLRRLRPVTVVLEDTALFLKLQQLQVLVSSCCLCCRVQLGVSVVVVRFLTLSAEI
LLGEVRMLRFCSSSLSFSFSSVSSCSTLFTTPRAEALFDLALGSDGLLGVEAEPLHHALG
VVDGAGDAGEPGLGALVHVVQRLAELQDAVHQDVHLVRLRQRGVSPRPERGRGHAARQNL
LYIYPQSLNFSSRQGSVRNIAVKMQFMAGEDPSQAICAWCRTLTCILCVFLYQVIFGKSS
CAEFYKEAYTPVIYHDKSPEFYEEVKMKIPANLTDNHHLLFTFYHISCQPKQNTPLETPV
GYTWIPLMQHGRLRTGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKGVFNVEVTAA
SSVHTQDPHLDKFFTLVYVLEEYSFPFRLKDGIITEGNVEAELKGSMAALKGALLDTCVR
FLHQLLNKLILLIVHPPVIAGQIVNLGRAAFEAMALLVNQIHKNLEGNLDQHGRNSLLSS
YIHYCFHLPTTEPAAPPTVGGATYELPIQYATLSRATARPSSLHLSRSKSISNSNPDLAS
TPASPDEEVQRIIGSKGIDRSHSWVNSAYAPGGSRSVLRRNPNSSCELKQLANDRSANRM
SAFIETASFLSPPTRHIARKLLHEELALQWVVSTSTVREAALQQAWFFFQLMVKSMAHHL
FLTSRXDVPRRQRFPDRFVDDIAALVCAISADIASRYQKDVELVERLNSSLAFFLNDLLS
LMDRGFVFNLVRTYYKQISNKLHTAQNPSSLTALRMDFIRIVCSHEHYVTLNLPCSTLSP
PASPSPSTSSTTSQSSAFSCLMQDQGVVSMFELSVPFRQQHFLSGLLLSELALILEPDGE
GVFFLHKKAISAVHSLLCSHDSDPRYTDPQVRAHIAQLYLPLVPVVMETLAQLHDFTDSS
PQRVRHASALIDDSDPDGNTINPSVAMAIAGSPLPHSKATRSPCRLWVEKAGRQGGALSA
ECSRTLLVCVLWVLKNADAALLEHWLSELSVLHINRLLDLLHLTVSCFEYKGKKALERIN
SLTFKKSQDMKARLEEAILGTIGARQEMVRRCRERSPYGSQENVRWRKNVTHWRQNTDRV
DKTKAEVEQESVVDGNLATEASLIVLDTLEIIVKMVVLSELKESVLGGVLRVLLHSMAGN
QSALFLQHCFTTQRALVFKFPEMLFEEDTELCADLCLRLLRHCSSSVGSVRSQASASLYL
LMRQNYEIGNNFARVKMQVTMSLSSLVGTSQNFNEEHLRRSLKTILTYAEEDLELRDSPF
PEQVQDLVFNLHMILTDTVKMKEHQQDPEMLLDLMYRIAKGYQNSPDLRLTWLQNMAGKH
SERGNHAEAAHCLVHSAALVAEYLNMLEDCRYLPIGCVSFQSISSNVLEESAVSDDILSP
EEEGICAGKYFSEAGLVGLLEQAAASFNMAAMYEAINEVYKILCPIHEANRDFKKLASVH
GKLQDAFNKVYNQSSGWERMFGTYFRVGFYGCRFGDLDEQEFVYKEPSITKLAEISHRLE
EFYSERFGDDVVEIIKDSSPVDKNKLDPNKAYLQITYVEPFFDTYELKERITYFDKNYNL
RXFMYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINVIQKEEVQLLFTSEDEI
LQ
NT seq 6309 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtctggcgaacgagcggagagcgttcgcccataagataaacaggacggtagct
gcggaggtcaggaagcaggtctctcgggagtatggctctccacagctgtccaaaaagcga
ggcggagccaatcagcaggtgcccctgacggaggtggtggagccggtggattatgaggaa
tatgtgagtagccacgcccccagccctgagcctggacctctcagacagctgatggagttc
cctaatgatgatctggagctcctcctgcaggagagggagtgtactacactggagcccgcc
ctgccggaggaagacacgctggatcccagagtccgagatgcgctgggggcgtacacagac
gactggctcatcattcagaggaagtatcagcgctacagcaccatgcagactcctcacaac
accgagcgacagcgcgagaaacagagaggcctgatcaagcagaccttcgaactggacgaa
gctgttgctgctgaacgacaggaggatcaggatgactctaagaggaggtcggtgtctctg
gacgacacgccgcggggaagctgggcctccagtatcttcgatctgaagaactcgtctccg
gacgctctgctcccgtctctgctggagcgcacggctgcggaggacatggaccgccgcaat
acagagaaccgccagcaggggcgccacccggacctgctggggctttaccccgcaccagac
gaggatgaggccgtggagaggtgctcagtcccagaggtgcccagagaacacacaggacag
agaatcatggtcaaatgcctttccctaaagtttgaaattgagattgagccgatatttggg
acgctggcgctgtatgacgtgaaggagaagaagaagatctcagagaacttccactttgac
ctgaactcagatcagacgaagggcctgctgcgcccccacaccccccacacggccatctcc
accctcgcccgctccgccatcttctccatcacctacccctctcccgacatcttcctggtc
atcaagctggagaaagtgctgcagcagggggatatcggggagtgctgtgagccgtatatg
gttatgaaggagtctgactctactaagcataaggagaagctggagaagctgaaggcccag
gcggagcagtactgcagcaggctgggtcggttccgaatgcccttcgcctggacggccatc
cacctcctcaacatcgtcagcagtgtcgggggcctggagcgctccgactccgattcagac
acagagcgtaaggggacgtggaacgagaggaagaagaagggatttgagaggatgagtgtg
ggggaagacatgtgcaactttaccaacttccgcccggctacgctcacagtcaccaacttc
ttcaaacaggagggggaccggctgagtgatgaggatctgtataagtttctagctgatatg
aggagaccgtcctccgtcctgcgccgcctcagacctgttacagtggttctggaggacacg
gctctgtttctgaagctccagcagctgcaggttctggtctccagctgctgtttgtgctgc
cgggtccagctgggtgtgtccgtggtggtggttcggttcctcaccctgagtgctgagatc
ctgttgggggaggtgaggatgctgaggttctgctccagctctctgagcttcagcttcagc
tccgtatcctcctgctccaccctgttcaccaccccccgggctgaggccctgtttgatctg
gctctcggttctgatggcctgctgggtgtcgaggccgagccgctgcaccacgctctcggt
gttgtggatggcgcgggcgacgcgggcgagccgggcctcggtgctctggtacatgtggtg
cagagactcgctgaactgcaggacgccgtacatcaggacgttcacctcgtccgccttcgc
cagcggggcgtctcgccgcgtcctgagcggggacggggacacgccgctcgccagaacttg
ctgtacatctatcctcagagtctgaacttcagcagcaggcagggctctgtacgcaacatc
gccgtcaagatgcagttcatggcaggagaagaccccagccaagccatatgcgcctggtgc
agaaccctcacctgtattctgtgtgtgtttttgtatcaggtgatcttcgggaagtccagc
tgtgctgagttctataaggaggcgtataccccggtcatctaccacgataagtctccagag
ttctatgaggaggtaaagatgaagattcctgctaacctgaccgacaaccaccacctgctc
ttcaccttctaccacatcagctgccaacccaaacagaacacgccgctggagacgcccgtc
ggctacacttggattcctctgatgcagcacggccgactgcgcaccggctccttcagcctc
cccgtatcagtggagaaacctccacccagctactccgtgctcacacccgacgtgcagctg
cccggaatgaagtgggtggataatcataaaggtgtgtttaatgtggaagtgacggccgcc
tcctccgttcacactcaggaccctcacctggataaattctttactctggtgtacgtgctg
gaagagtactccttcccgttccggctgaaggacgggataatcaccgaggggaacgtggag
gcggagctaaagggcagcatggcggctctgaagggggcgctgttggatacctgcgttcgc
ttcctgcaccagctgctcaacaagctcatcctcctcatcgtccatcctcctgtaatcgca
ggacagatcgtgaatctgggccgggctgcgttcgaggcgatggctctcctggtgaatcag
atccataagaacctggaggggaacctggatcagcacggccgcaacagcctcctgtcctcc
tacatccactactgcttccacctgcccaccaccgagcctgcagcgccccctactgtgggc
ggagctacctacgagcttcctatccagtacgccacgttatcccgagcgacggcccgtccc
agcagtctgcacctgtcccgctccaagagcatcagcaactccaacccggacctcgcctcc
acccccgcctcacctgacgaggaggtgcagaggatcatcggcagcaagggtatagatcgc
tcccactcctgggtaaattctgcttacgctcccggcggctccagatccgtactccgccgg
aaccccaactccagctgtgagctcaagcagctggccaatgatcggagtgctaaccgcatg
tcagccttcatcgagaccgcctccttcctctctccaccaaccagacacatcgccaggaag
ctgctgcatgaggagctggcgctgcagtgggtggtgagcaccagtacggtgagggaggcg
gcgctgcagcaggcctggttcttcttccagctgatggtgaagagcatggcccaccacctg
ttcctcacctcccgcntggacgtcccgaggcggcagcggttccccgaccggttcgtggac
gatatcgccgctctggtctgcgccatcagcgcagacatcgccagcagataccaaaaggat
gtggagctggtggagagattgaacagcagtttggcgtttttcctgaatgatctgttgtct
ctgatggaccgaggctttgtgtttaacctcgtccgcacctattataaacagatctccaat
aagctgcacacggctcagaaccccagctctctgacggcgctgaggatggactttatccgg
atcgtctgcagccatgagcactacgtcaccctcaacctgccctgctccaccctcagcccc
cccgcctccccctcaccctccacctcctccaccacctctcagagttctgcgttctcctgt
ctgatgcaggatcagggtgtggtcagcatgttcgagctctccgttcctttccgtcagcag
cacttcctgtccggccttctgctctcagagctcgccctcatcctggagcctgacggagag
ggggtgttcttcctgcataagaaggcaatcagtgcggttcactcgctgctctgcagtcac
gactcggacccgcgctacaccgacccgcaggtccgcgcccacatcgcccagctctacctg
cccctcgtacccgtcgtcatggagacgctcgcacaactgcacgactttacagactcctcc
ccccagcgggtaagacacgcctctgcgctcatcgacgacagcgacccagacggcaacacc
atcaacccgtctgttgccatggcgatagccggctcaccgctgccccattccaaagccacc
cgttcgccctgccgtctgtgggttgagaaagccgggcgtcagggcggggctctgtcggcg
gagtgcagcaggacgttgctggtttgtgtcctgtgggtcctgaagaacgctgacgcggcg
ctgctggaacactggctctctgaactctccgtcctgcacatcaaccgcctgctggacctg
ctgcacctcaccgtctcctgcttcgagtacaaggggaagaaggctctggagaggatcaac
agtctgacctttaagaaatctcaggatatgaaagcccgtctggaggaggccatactcggc
accatcggagcccggcaggagatggtccgccgctgcagagagaggagtccatatgggagt
caggagaatgtgagatggaggaagaacgtcactcactggagacagaacaccgaccgagtc
gacaagacgaaggcggaggtggagcaggagtcggtggtggatggaaacttggcgactgaa
gcctctttaatagtgctggatactctggaaatcatcgttaaaatggtggttctgtcggag
ctgaaggagagtgttctgggtggggttctgagagttctgctccacagcatggcgggaaac
cagagcgccctctttctgcagcactgcttcactacacagagagctctggtctttaagttc
ccggagatgctgtttgaggaggatacggagctgtgtgcggatctgtgtttgcggttactg
cggcactgcagcagcagcgtgggttcggttcgcagccaagccagcgcctccctctacctc
ctcatgagacagaactacgagatcggcaacaactttgcccgggtgaagatgcaggtgacc
atgtccctgtcctcactggtcggcacgtcccagaactttaatgaggaacacctgcgccgc
tccctgaagaccatcctcacctacgctgaagaagacctggagctccgggactcgcccttc
ccagagcaggttcaggacctggtgtttaacctgcacatgatcctcacagacactgtgaag
atgaaggagcatcagcaggaccccgagatgctgctggacctgatgtacagaattgctaaa
ggctatcagaactctccggacctgcgtctgacgtggttgcagaacatggcggggaagcac
tctgagagggggaaccacgccgaggcggcgcactgcctcgtccacagcgccgccctggtg
gctgagtacctcaacatgctggaggactgtcgctatctccctattggctgcgtctccttc
cagagcatctcctctaacgttctggaggagtcggcagtgtctgatgatattctgtccccg
gaggaggagggaatctgtgcagggaagtacttcagcgaggccgggctggtggggctgctg
gaacaggcagcagcttcttttaacatggcggcgatgtatgaagcgataaacgaggtgtat
aagatcctctgcccgattcacgaggccaaccgagactttaagaagctggcgtccgtccac
ggcaaactgcaggacgccttcaacaaggtctacaaccagagctcgggatgggagaggatg
ttcgggacgtactttcgcgtggggttttacggctgtcgcttcggggatctggacgagcag
gagtttgtgtataaggagccgtccatcaccaagctggctgagatatcacacagactggag
gagttttactcagagcggtttggagacgatgtggtggagatcatcaaagactccagccct
gtggacaagaacaagctggaccccaacaaggcgtatctccagatcacctacgtggagccg
tttttcgacacctacgagctgaaggagcgaatcacgtacttcgataagaactacaacctg
cgcnacttcatgtactgcacgccgttcacactcgacggccgagcgcacggggatctgcac
gagcagtacaagcgcaagaccatcctcaccacctcgcacgccttcccctacatcaaaacc
cgcatcaacgtcatccagaaggaggaggtacagcttctctttacgtctgaggatgagata
ttacagtga

DBGET integrated database retrieval system