KEGG   Astyanax mexicanus (Mexican tetra): 103033452
Entry
103033452         CDS       T05042                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amex01002]
    103033452
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103033452
Peptidases and inhibitors [BR:amex01002]
 Metallo peptidases
  Family M1
   103033452
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N KxDL
Other DBs
NCBI-GeneID: 103033452
NCBI-ProteinID: XP_022523965
Ensembl: ENSAMXG00000004920
Position
Unknown
AA seq 960 aa
MMQKPRALLFSLSFSSASSSHLLLHPAFSRTTRFLTISQQAMYLLALLLYVSPALAGVTH
VSREDEPSFPVATDGSPFPWNKMRLPESVSPLHYDLLIHPNLTSLDFTGSVKIQVKVHEE
TNTIVLHSKDLSISKAVLLSSGEGQGQTLRVLEYPAYHQIALVSDGTVLKKGGEYVFQLD
FEAKLSENFHGFYKSTYRTSEGEERVLASTQFEATSARAAFPCFDEPAFKANFTISIRRE
SRHISISNMPKLRTLPVVGGLLEDQFDTTVKMSTYLVAFIVCDFLSISKNTQHGVKISVY
AVPEKIDQAQFALDAAVRLLDFYDDYFDIPYPLPKQDLAAIPDFQSGAMENWGLTTYRET
ALFFDPHKSSASDKLGITMIIAHELAHQWFGNLVTMQWWNDLWLNEGFAKFMEFVSVNIT
NPELEVEDYFMGKCFEAMEVDCLSSSHPVSTPVENPAQIQEMFDDVSYDKGACILHMLRE
FLTPEEFKSGIVRYLKKYSYQNTVNTHLWESLTTEQHAEEELDVRAMMETWTLQEGFPLI
TVEVKGREVRLSQERYLKGEDPSQTSGFLWHVPLTYVDSNSATVHRFLLKTKTDVLYLPE
EVDWIKFNVDMSGYYIVHYEGSGWDDLITLLKHNHTALSSNDRASLINNVFQLVSVGKLE
LDKALDLSLYLSRETKSVPVTQGLSELVPLYKLMEKRDMETLENQMKSYIVHLFRELIDR
QTWTDDGSVSERMLRSYLLLFACVRGHPPCISTATQLFKKWKESDGNMSLPNDVSMAVFA
VGARTEEGWDFLFEKYSKSIYTSLKSRIKSALSITPLAHKLKWMMEQSFEGSVMKTQDLP
YVVTSISKNPKGYKHAWDFLRTNWHSLVKKFDLGSHSIAHMVTGVTSQYSTREMLQEIQE
FFNSLTVETGAELRCLQQALENVEENIRWMDKNVPLLQAWLNQNHPDPVQRDDLYQHVEL
NT seq 2883 nt   +upstreamnt  +downstreamnt
atgatgcaaaagccccgcgctcttttattttcactttcattctcttcagcaagcagctct
cacctcctcctgcatcctgcattcagccgaactacacgattcctgaccatatcccagcag
gccatgtacctcttggccctcctcctgtatgtttctccagctttggctggagttacacat
gtcagcagagaggacgagccttctttcccagtagcaactgatggatcaccgttcccctgg
aacaagatgaggcttccagagtcagtttctcctctgcactatgacctgctcatccaccct
aatctcacaagcctagactttacaggaagtgtgaagatccaagtgaaggtccacgaagaa
accaacaccattgtcctccacagcaaggacctcagcatctccaaagcagtgctgttgagc
tcgggtgaaggtcagggtcagactctgagagtactggagtaccctgcttaccatcaaatc
gctctagtgagtgatggtacagtgctgaagaagggtggcgagtacgtttttcagctggac
tttgaggccaagctttcagaaaacttccatgggttttacaaaagcacatatcggaccagt
gaaggagaagagagggttctggcctccacccagtttgaggcgaccagtgctcgtgcagcc
ttcccctgtttcgacgagccggccttcaaagccaacttcactattagcatccgcagagag
agcagacacatctccatctccaacatgccaaagctgaggacgctgccagttgtaggcggc
ctgcttgaggaccagtttgatactactgtgaagatgagcacatacctggtggccttcatt
gtctgcgactttttatccatcagcaagaacacccagcatggagtcaagatctctgtgtac
gctgtccctgagaagattgaccaggcccagtttgcactggatgctgcagtgaggctgctg
gacttctacgatgattactttgacattccctaccctctccctaaacaagatctggcagcc
atcccggactttcagtctggagccatggagaactggggactgaccacttacagagagacc
gccctgttcttcgacccccacaagtcatccgcctccgacaagctgggcatcaccatgatc
atagcgcatgagctcgcccaccagtggtttggaaatctggtgacgatgcagtggtggaac
gatctctggctgaacgagggattcgctaagttcatggagttcgtttctgtaaacatcacc
aaccctgagctggaagtggaggactattttatgggaaagtgctttgaggcgatggaagtg
gactgtttaagctcctcccaccctgtgtcaacccccgtagagaacccagctcagatccag
gagatgtttgatgacgtgtcttatgataagggtgcctgcattctgcacatgctgagagag
ttcctgacccctgaggaatttaaatctggtattgtgagatacctgaagaaatacagctac
cagaacacagtcaacacacacctgtgggaaagcctgaccactgagcagcatgcggaggag
gagctggacgtgagggccatgatggagacgtggaccttgcaggaaggcttcccgctcatc
acagtggaggtcaaaggtcgtgaggttcgactgagccaggagcgatacctgaaaggggag
gacccctcccagaccagcgggttcctgtggcacgtcccgctgacctacgtcgacagtaac
tctgccacggtgcatcgctttctgctgaagaccaagactgatgtgctgtacctgccagaa
gaggtagactggatcaagtttaacgtggacatgagcggatattacatcgtccactacgaa
gggtcaggctgggacgacctcatcactctacttaaacataatcacaccgccctcagcagc
aacgaccgggccagtctcatcaacaacgtcttccagctggtcagtgtggggaagctggaa
ctggataaagctctggacctgtctctgtacctgagccgtgagactaagtccgtccctgtg
acacagggcctcagcgaactcgtcccactctacaaactgatggagaagagagacatggag
acactggagaaccagatgaagagttacatcgtgcacctgttccgcgagctcatagaccgg
cagacgtggactgatgatggctcggtgtccgagaggatgctgcgcagttatctcctcctc
ttcgcctgtgtgaggggtcaccccccctgcatctccaccgccacacagctcttcaaaaag
tggaaggagtctgatggcaacatgagtctccctaatgacgtcagcatggcagtgtttgcg
gttggcgctcgcactgaggagggctgggacttcctgttcgagaaatacagtaaatctatc
tacacatccctgaagagccgcatcaaatccgccctgtccatcactcctcttgctcacaaa
ctcaaatggatgatggagcagagttttgagggttctgtgatgaagacacaggatctgccg
tatgttgtgacgtccatcagcaagaatcctaaaggctataaacacgcctgggacttcctg
aggaccaactggcactcgctggtgaagaagtttgaccttggatcccattctattgcccac
atggtaacaggggtgaccagccagtactccaccagggagatgctgcaggagattcaggag
ttcttcaactccctcacagtggagactggagcagagctgcggtgtctccagcaggctctg
gagaacgtggaggagaacatccgctggatggacaagaacgtgccattgctccaggcttgg
ttgaaccagaaccatccagacccagtccagcgagatgatctgtatcaacatgtggagctg
taa

DBGET integrated database retrieval system