KEGG   Astyanax mexicanus (Mexican tetra): 103034215
Entry
103034215         CDS       T05042                                 

Definition
(RefSeq) acid-sensing ion channel 1A-like isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amex04040]
    103034215
Ion channels [BR:amex04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103034215
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 103034215
NCBI-ProteinID: XP_022525949
Ensembl: ENSAMXG00000016831
Position
6
AA seq 498 aa
MKPASVMDLKVEPAPADEPPPLQVFAHMSTLHGIAHIFTYDRITLRCCLWLLFFLSSVAF
LVCVCVDRVLFYLEYPHVTKVDEVVAPAMVFPAVTLCNLNAFRFGRVTRNDLYHAGELLA
LLNSRYEIRDVHLIEESVLESLKTKADFQNFKPRPFNMMEFYNRTGHDIRDMLLSCQFRG
SPCRPEDFKVVFTRYGKCYTFNSGETGPLLISMKGGMGSGLEIMLDIQQDEYLPVWGETD
ETSFEAGIKVQVHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLVYLPPPWGNCKTGTLDS
DFFTAYSISACRIDCETRYLVENCNCRMVHMPGDAPYCTPELYKECAHPALDFLVERDND
YCLCETPCNTTRYSKELSFVKIPSKASAKYLAKKFSKSEKYIADNVLVLDVFFEALNYET
IEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYEVAKYKLCRCSEKKNQSSSAD
HGTVLGLDDVKCHVSNFH
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaaacctgccagcgtgatggatcttaaggtggagccggcgcctgcagacgagcctccg
ccgctccaggtgttcgctcatatgtctacgctgcatggcattgcccacattttcacctac
gacaggatcacgttgaggtgctgcctgtggctgctgtttttcttgagctccgtagccttc
ctggtgtgtgtgtgtgtagaccgggtgctcttctacctggagtatccgcacgtgaccaag
gtggacgaggtcgttgcgcctgccatggtcttccccgctgtgacactctgcaacctgaac
gccttccgctttggcagggtcacgcgcaatgacctgtaccatgctggggagctgcttgcc
ctgctcaactcaaggtatgagatccgtgacgttcatctgatcgaggagagcgtcctcgag
tctctgaagaccaaagccgacttccagaacttcaagccccgccccttcaacatgatggag
ttctacaaccgtacgggacacgacatccgagacatgctcctctcctgccagttcagaggc
tcgccgtgccgacccgaagacttcaaagtggtgttcacgcgctatgggaagtgctacacg
tttaactctggtgagactgggccgctgctgatcagtatgaaggggggtatggggagcgga
ctggagatcatgctggacatccagcaggacgaatacttgccagtttggggagaaacagat
gagacctcgtttgaagcggggattaaagttcaggtacacagtcaggatgagccgccattc
attgatcagctggggtttggagttgctccggggtttcagacctttgtctcctgtcaagag
cagcggctggtctatctgccccctccctgggggaactgcaagacaggaacactggactcc
gacttcttcactgcctacagcatcagcgcatgccgcatcgactgcgagacacgatacctt
gttgagaattgcaactgtcgaatggttcacatgcctggtgatgcaccgtactgcaccccg
gagctgtataaggaatgtgcacatccagcccttgatttcctggtggagcgggataatgac
tactgcctgtgtgagactccgtgtaacaccacccgctacagcaaagagctctccttcgtc
aagatccccagcaaagcctccgccaagtacctcgccaagaagttcagcaagtccgagaag
tacatcgcagacaacgttttggtgctggacgtcttttttgaagctctgaactacgagacc
attgagcagaggaaagcttatgaagtggcaggtcttctgggtgatatcgggggacagatg
ggactcttcattggagcaagcatcctcaccattcttgagctttttgactatctgtatgag
gtggccaagtacaagctgtgtcgctgttccgaaaagaagaatcagagcagcagcgcggat
cacggcaccgttctgggcctcgacgacgtcaaatgtcacgtcagcaacttccactga

DBGET integrated database retrieval system