KEGG   Astyanax mexicanus (Mexican tetra): 103034393Help
Entry
103034393         CDS       T05042                                 

Gene name
mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00450  Selenocompound metabolism
amex00970  Aminoacyl-tRNA biosynthesis
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103034393 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103034393 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amex01007]
    103034393 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amex03016]
    103034393 (mars)
Enzymes [BR:amex01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103034393 (mars)
Amino acid related enzymes [BR:amex01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103034393 (mars)
Transfer RNA biogenesis [BR:amex03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103034393 (mars)
 Prokaryotic type
   Other AARSs
    103034393 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 Anticodon_1 GST_N_3
Motif
Other DBs
NCBI-GeneID: 103034393
NCBI-ProteinID: XP_022531355
Ensembl: ENSAMXG00000017335
Position
13
AA seq 920 aa AA seqDB search
MKLFVSEGNPHCVKALAALELSGLKCDVQLVNHEERVVPFLNRPVIPVLLLPSGQHLFSA
NAICQLLLEMAGKSTDESKQLLEWEATELQPALLQALHKQALQGKSSEAAAVLKGPLGWL
DQYLSKRTTSFLTEEILADIVLGAALYPVLSDPAFEVGDLPSLQAWFNHVRELPACQSAA
QKVLNGKGLEALKGFLQKQPVPHLQRRDSPPSASEMEESEPVMTQEEIEAAAQAWRKGLP
RCSATPQKKHPILPEEGKRNVLLTSALPYVNNVPHLGNIIGCVLSADVFARYGRLRGWNL
LYVCGTDEYGTATENKAREEGLTPQEICDKYHAVHCAIYKWFQISFDYFGRTTTERQTEI
SQNIFWRLHERGFLLEDTVEQLHCENCQRFLADRFVEGVCPHCRYPEARGDQCDKCGRLI
NAVELKEPQCKVCQQTPVVRSSKHLFLDLPKLESELEQWLDKSTSSGDWTNNAKNITRSW
LRDGLKPRCITRDLKWGTPVPHPDYSDKVFYVWFDAPIGYLSITANYTSEWEKWWKNPQQ
VELYNFMAKDNVPFHSVVFPCSLLGAQDNYTLVNNLVATEYLNYEDTKFSKSRGVGVFGD
MAKDTGIPSDVWRFYLLYLRPEGQDSAFSWADMALKNNSELLNNLGNFINRAGMFVSKFF
EGHVPEMVLQDEDKRLIAQVCWELKQYIQLLDKVRIRDALKCILNISRHGNQYIQVNEPW
KKIKGGDDDRQRAGTVTGVSVNVACLLSAMLEPYMPTVSQTIRDQLQAPAHCSSATLGTD
GGFLCTLSAGHPIGTVSPLFQKLESEQIEALKKRFGGQQPEDETPAGEVPSSMVNSAQPK
PPAAVEPTVNASVSAADPERAKQLAAAVAEQGDKVRALKSQKAEKSVITAEVTKLLELKK
ELAVAEGKNPEPSPQKGKKK
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtttgtgagtgaggggaacccgcactgtgtgaaggcgctggcggcgctggag
ctgtcggggttgaaatgtgacgtacagctggtgaaccacgaggaaagagtggtgcccttc
ctaaatcgtccagtcatacctgttctgctgctccccagcgggcaacacctcttcagtgct
aatgccatctgccaattactgttggagatggctgggaagtccactgatgagagcaagcag
ttactggaatgggaagcaacagaattgcagccggcgctgctgcaggcactccataagcag
gcactacaggggaagtccagcgaggctgctgctgtgctgaagggacctctgggctggctg
gatcagtacctctccaaacggaccacatcattccttactgaggagatattggcagatatt
gtgctgggggcagcgttgtatcctgttctgtctgacccagcttttgaagttggtgactta
ccgtcactgcaggcctggtttaaccatgtaagggagctcccagcgtgtcagtcagctgct
cagaaggtcctaaatgggaaggggcttgaagctctgaagggtttccttcaaaagcagcca
gttcctcacctacagcgaagggacagcccacccagtgcctctgagatggaagaatcagag
cctgtgatgactcaggaggagattgaagcagctgctcaggcctggagaaaaggacttcca
cggtgctcagccaccccacagaagaaacaccccattttaccagaagaaggaaagaggaat
gtgctgttgacgagtgcactgccctacgtaaacaacgtgcctcacctgggaaacattatc
ggctgtgtgctcagcgctgatgtatttgccagatatggacgtttgcgaggctggaacttg
ctgtatgtgtgtggaacagatgagtacggcactgcgacggagaacaaggctcgtgaagag
ggcctgacgccacaagagatctgtgacaaataccacgctgtccactgtgccatttacaaa
tggttccagatcagcttcgattactttggccgcaccacaaccgagcgacagactgaaatc
tctcagaacattttctggcgtctgcatgagcgaggctttctgctggaggacacagttgag
cagttacactgtgagaactgtcagcgtttcctggctgaccgctttgtggagggtgtctgt
ccccactgcagatacccagaggccagaggggaccaatgcgacaaatgtgggcgtctcatt
aatgctgtggagctcaaggagccgcagtgtaaggtgtgccagcagactcccgtcgttcgt
tcctctaaacatctgtttctggacctgcccaagcttgaaagcgagctggagcagtggctg
gacaaatccacaagttctggggactggacaaataatgccaagaacatcactcgctcgtgg
ctgagagatggtctgaaaccacgctgcatcaccagagatctgaagtgggggacgcccgta
cctcacccagactacagcgacaaggtcttttatgtgtggttcgacgcccccattggctac
ctctctataacagccaactacaccagtgaatgggagaagtggtggaagaatccgcagcag
gtggagctgtataacttcatggcgaaggacaacgttccgttccacagcgtggtgttcccc
tgctctctgctcggagctcaggataactacacactcgtcaacaacctggtggctacagaa
tatctgaactatgaggacacaaagttctctaagagccgaggtgtgggggtgtttggtgac
atggctaaagatacaggaattccgtctgatgtttggcgtttctacctgctgtatctgaga
cctgagggccaggactccgccttctcctgggctgatatggctctgaagaacaactccgag
ctgctcaacaacctgggaaattttatcaacagggcagggatgtttgtcagtaagttcttt
gagggccatgtgcccgagatggtgctgcaggatgaagataagcgtctcattgcacaggtg
tgctgggagcttaagcagtacatccagctactggacaaagtcaggatccgtgatgcccta
aagtgcatcctcaacatctctcgccatggcaaccagtatatccaggttaacgaaccctgg
aagaagatcaaaggaggagacgacgacaggcagcgtgcgggcacggtgactggtgtgtcg
gtgaatgtggcgtgtctcctatcagccatgctggagccctacatgcccacggtcagccag
accatccgtgaccagctgcaggctccagctcactgctccagtgccacgttgggcaccgac
ggaggtttcctctgcacgctctcagctggccatccgatcggcacggtcagtccgttgttc
cagaagctggagtctgagcagatcgaggctctgaagaagagattcggaggacagcagcca
gaggacgagacccctgcaggagaggtccccagcagcatggtgaactcagcacagcccaaa
ccgcctgctgctgtagagcccactgttaacgcaagtgtgagtgcagccgacccggagaga
gccaaacagctggctgctgcagtggctgaacagggtgataaagtgcgtgctctgaagtct
cagaaggcggagaagtctgtgatcacagcggaggtcaccaaactcctcgagctgaagaag
gagctcgctgtggctgaaggcaaaaaccctgaaccctcccctcagaagggaaagaagaag
tga

DBGET integrated database retrieval system