KEGG   Astyanax mexicanus (Mexican tetra): 103037415Help
Entry
103037415         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00730  Thiamine metabolism
amex00790  Folate biosynthesis
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    103037415
   00790 Folate biosynthesis
    103037415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amex04147]
    103037415
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:amex00537]
    103037415
Enzymes [BR:amex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     103037415
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103037415
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:amex00537]
 Enzymes
  103037415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 103037415
NCBI-ProteinID: XP_022538195
Position
22
AA seq 539 aa AA seqDB search
MQQGFGRRWFEVRTMKVITLLLTCLVCRGSGKPQFPEQEKDPGFWNAWAQRTLRSALTLQ
EPNRNIAKNLILFLGDGMGVPTVTAARILKGQLSGQYGEEVQLEMDKFPYVSLSKTYNTN
AQVPDSAGTATAYLCGVKANEGTVGVSAAAVRGQCNTTRGNEVTSILKWAKESGKSVGIV
TTTRVNHATPSAAYAHCVDRDXYSDGEMPPEAVQAGCKDIARQLMENIPDINVIMGGGRK
YMLPKNTSDVEYPGEKKHSGTRKDGRNLIQEWTDRMRDKKGYYVWNKKDLLSINPSSADY
LLGLFEPGDLQYDLERDSSTDPSLTEMVEVAIKILRKNPEGFYLLVEGGRIDHGHHEGKA
KQALHEAVEMDRAIGRAGLLTSVHDTMTVVTADHSHVFNFGGYTLRGNSIFGLAPMVSDV
DQKPFTSILYGNGPGFKLINGSRVNVSTEDYQQNDYQAQSAVPLRMETHGGEDVAVFSKG
PMAHLLHGVQEQNYIPHAMAYAACIGQNRAHCRTRSSATPLAITTPSLFLLITAAWLLC
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggggtttggaagacggtggtttgaagtcagaacgatgaaggtcatcacactc
ctcctcacctgcctggtgtgtagaggttcaggaaaacctcagtttccagaacaagaaaag
gatcccgggttctggaacgcttgggctcagcggaccctgaggagtgcactgacccttcag
gagcccaacaggaacatcgccaagaacctgatcctcttcctcggagatgggatgggcgtt
ccgacggtgacggcggcccggattctgaagggtcagctgagtggtcagtacggagaggag
gttcagctggagatggataaattcccctacgtttctctctctaagacctacaacactaac
gcccaggttcccgacagcgccggcaccgccaccgcgtatctgtgcggcgtgaaggccaac
gagggcacggtgggcgtcagcgccgccgccgtcaggggccagtgcaacaccacccgcggc
aacgaggtcacctccatcctgaaatgggctaaagaatcagggaagtctgtgggcatcgtc
acgaccacgcgggtaaatcacgcgacccccagcgccgcgtacgctcactgcgtggaccga
gacntgtactcggatggagagatgccgcctgaggcggtgcaggctggctgcaaggacatc
gcccgacaactgatggagaacatccccgacattaacgtaattatgggcggaggacgtaaa
tacatgctgcccaagaacacgtcggacgtggaataccccggagagaagaagcacagcggg
acacgcaaagacgggaggaatctgatccaggagtggactgacagaatgagagacaagaag
ggttattacgtgtggaacaagaaagatctcctctcaataaacccctcttctgctgattac
cttctggggctgtttgagccgggagatctgcagtacgacctggagagagacagcagcact
gacccctccctcacggagatggtggaggtggccattaaaatcctccggaaaaaccctgaa
ggattttatctgctggtggaaggtgggcgtattgatcacgggcatcacgagggtaaggct
aagcaggctctgcacgaggcggtggagatggaccgcgctattggccgagccggactgttg
accagcgtacacgacaccatgactgtagtgaccgctgatcactctcacgtctttaacttc
ggaggatacacactgcgcggaaactccatattcggtttggctcctatggtcagtgatgtg
gatcagaagcccttcacttctatactgtacggaaacggccccgggttcaaactgatcaac
ggctccagagtcaacgtctccacagaggactaccagcaaaatgattaccaggctcagtcg
gcggttccgttacggatggagacgcacggcggtgaggacgtggccgttttctctaagggt
ccgatggcccacctgctgcacggcgtccaggagcagaactacatcccccacgccatggcc
tacgccgcctgcatcggccagaacagagcacactgccggacccggagcagcgccacgccc
ctcgccatcaccacgcccagcctgttcctcctcatcacagccgcgtggctgctgtgctga

DBGET integrated database retrieval system