KEGG   Astyanax mexicanus (Mexican tetra): 103039125Help
Entry
103039125         CDS       T05042                                 

Gene name
gatc
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00970  Aminoacyl-tRNA biosynthesis
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103039125 (gatc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:amex03029]
    103039125 (gatc)
Enzymes [BR:amex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     103039125 (gatc)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     103039125 (gatc)
Mitochondrial biogenesis [BR:amex03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    103039125 (gatc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln MTTB UPF0561
Motif
Other DBs
NCBI-GeneID: 103039125
NCBI-ProteinID: XP_007233543
Ensembl: ENSAMXG00000004252
Position
Unknown
AA seq 228 aa AA seqDB search
MFHPSSDRWSRLIYLSAVNIQKSLLLARISTQNYRETAARCKCSATARSLHTTAPLRPAE
PRCGVSELHAHGVRTAGRRAVRCRLESSRSSSSSSSHNSKVPQFPTWEPVAESQLPPPTK
VSLDLVDKLERLALVDFGNQEGIVCLEKAIRFADQLHVVDTDGVEPMDSVLEDRALYLRE
DTVTEGDRAEELLQLSKNTVEDYFVAPPGNIPLPKREERSAMLKHADF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttccacccctcttcagacagatggagcagattaatctatttatctgctgtaaatatt
cagaaaagtctgttattagctcgtatctccacacagaattacagagaaacagcggcgcgg
tgtaaatgtagcgctacagcacggagcttacacacaactgccccgctgaggcctgcggaa
cctcggtgtggagtatcggagctacacgcacatggagtcaggacggcgggcaggagagct
gtcaggtgccggttggagtcgagccggagctcgagtagtagttcttctcataattcaaag
gtcccccagtttcccacctgggagccagtagccgagagtcaacttcccccacccacgaaa
gtctcactggacctggtggataagctggagagactcgctcttgtagacttcggtaatcag
gagggcattgtctgtctggagaaagccatccggtttgcagaccagcttcacgtggtcgac
acagacggtgtggagccaatggactctgtgctggaagacagagctttatatctgagagaa
gacaccgttacggaaggagaccgtgctgaggagctccttcagctctctaagaacacagtg
gaagactattttgtagctcctccgggaaatatcccacttccaaagagagaggagcgatct
gccatgctgaaacatgctgacttctga

DBGET integrated database retrieval system