KEGG   Astyanax mexicanus (Mexican tetra): 103040962Help
Entry
103040962         CDS       T05042                                 

Gene name
blvrb
Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00740  Riboflavin metabolism
amex00860  Porphyrin and chlorophyll metabolism
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    103040962 (blvrb)
   00860 Porphyrin and chlorophyll metabolism
    103040962 (blvrb)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     103040962 (blvrb)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     103040962 (blvrb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 103040962
NCBI-ProteinID: XP_007251631
Ensembl: ENSAMXG00000021462
UniProt: W5LQ39
Position
18
AA seq 207 aa AA seqDB search
MADAVKNVALFGCTGMTGAATLPIAAAAGYNVTVLVRDPSRLPADHKASRVVVGDVLNKE
DVKKTLEGQDAVIIILGTRNDLSPTTMMSEGTRNILEAMKARGIRKVIGCMSAFLLWDRS
KVPPRLVPVTEDHDRMYTVLKESGLDYVAVMPPHIADNHPLTEKYTATENMLKGRVISKH
DLGHFFVKCLSTSEWDGKTVGVCGEYS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcggtgaagaacgtggcgctgttcggctgtaccgggatgaccggagccgcg
accttaccgattgcagctgctgcaggctataatgtgactgtgctggtgagggatccgtcc
agactgcctgccgaccacaaagcctccagagtggtggtgggagacgtgctgaataaggag
gacgtgaagaagacgctggagggtcaggatgcggtaatcatcatcctgggcaccaggaac
gacctcagtcccactaccatgatgtctgagggaacacgtaacatcctggaagccatgaag
gcccgcggcatccgcaaggtcattggctgcatgtctgccttcctgctgtgggacaggagt
aaggtgcccccccgcctggttcctgttactgaagaccatgaccggatgtacacagtgctg
aaagagtctggcctggattatgtggctgtaatgccccctcacatcgccgataaccaccct
ctgacggagaagtacacagcgaccgagaacatgctgaaaggaagagtcatttccaaacac
gacctcggacacttcttcgttaagtgtctgtccacctcagagtgggatgggaagacggtg
ggcgtttgtggagagtacagttaa

DBGET integrated database retrieval system