KEGG   Astyanax mexicanus (Mexican tetra): 103041290Help
Entry
103041290         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04270  Vascular smooth muscle contraction
amex04350  TGF-beta signaling pathway
amex04510  Focal adhesion
amex04530  Tight junction
amex04810  Regulation of actin cytoskeleton
amex05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103041290
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103041290
   04530 Tight junction
    103041290
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103041290
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103041290
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103041290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103041290
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amex03036]
    103041290
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103041290
Protein kinases [BR:amex01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   103041290
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103041290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding Cortex-I_coil HR1 Pkinase_C APH
Motif
Other DBs
NCBI-GeneID: 103041290
NCBI-ProteinID: XP_022521174
Position
Unknown
AA seq 1095 aa AA seqDB search
MSSAENLTARFEKIDAMLKDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLSRYK
DTISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKATRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSSWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHAMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
EDSDISKDAKSLICAFLTDREVRLGRNGVDEIKRHSFFKNDQWTWDNIRDTAAPVVPELS
SDIDTSNFDDIEEDRGEEETFPIPKAFVGNQLPFVGFTYYSGNQSSRCSSTKTSDKHGST
TKEDKSHLENLQKRIHQLEEQLHGEMQLKDEMEQKCRASNIKLDKMMKELDEESNARKSV
EASLSLLEKDKLMLQHRVTDHQRKADQEAEKRRNLENEVSSLKEQLENLRKISQNTQASS
DKIAQLQHQLEEANDLLRAESDTAARLRKSQTEMGKAMSQLEGLNGELQEKARASDSARQ
QLERELLQLQNTLDTERRTCSQGSEEIRQLQARMMGLQEDNKNLRLSLSKVEAERKQAQE
RSNSLEKEKNSLEIDLNYKLKILQQRLDQEITEHRVSRAQLTDKYESIEEAKSAAMHAVE
QKVSEESVLRLRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKVLRVQLD
QECSKRAVAQTDLKTRTGEVERLRGSEKQLKQEINTTLENKRSLEFQLAQLTKQYRGNEG
QMRELQDQLEAEQYFSTLYKTQVKELKEELEERNRLVQDAQKKVQEMHAERDSLMAQLDL
TVTKAESEQIFRERLXYSTARVTIATHTLIHTLIQEISERDSTIARLEDSNKTLTKDVET
LSREKAELDEKLRSQEDEYSAQKEEISNSIKANYEKILNTERTLKTQAVNKLAEIMNRKD
MKLDRKNRGSTTDLRKKEKENRKLQLELNQEKEKFNHMAIKYQKELNEMQAVRAGASQTN
HTRINQSINILSYTV
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgcggagaatttgacggctcggttcgagaaaatcgatgccatgctgaaggac
ccgaaatccgagatcaacaccgactgccttctggacggtttggacgctctggtctatgac
ctggatttccccgccctgaggaagaacaaaagcatcgacaacttcttaagcagatataag
gatacgatcagtaaaatacgagatctgcgtatgaaagcggaggactatgaggtggttaag
gtcatcgggagaggagcgttcggagaagttcaactggtgagacataaagccaccaggaaa
gtttacgctatgaagcttctcagtaagtttgagatgattaagagatcagattctgctttc
ttctgggaggagagggacattatggccttcgctaacagctcatgggtcgtacagctgttc
tacgcgttccaggacgaccgctacctctacatggtgatggagtacatgccgggcggtgat
ctggttaatctgatgagtaattacgacgtcccggaaaaatgggctcggttctacacggcc
gaggtggtgctggcgctggacgggattcacgccatgggatttatacacagggatgtgaaa
cccgacaacatgttgctggataaatcaggccacttgaagctggcggactttggcacctgt
atgaagatgaataaggacggtatggtacgatgtgacacggcggtgggaactccagactac
atttctccagaggtactgaagtctcagggtggagacggatactatggccgagagtgcgac
tggtggtccgtcggggtcttcctgtatgaaatgcttgttggtgacacgccgttctacgct
gattcgctggtgggaacctacagtaaaatcatgaaccacaagaacgccctgacctttccc
gaggacagcgacatctccaaggacgccaaaagcctcatctgcgccttcctgacggacagg
gaagtgcgattgggacggaacggagtggacgagataaagagacactctttctttaagaac
gatcagtggacctgggacaacatcagagacaccgctgccccggtggtgccggagttgagc
agtgatattgatacgagtaattttgatgatattgaggaggatcgaggagaggaggagacc
ttccccatccctaaagccttcgtgggaaaccagctgccgttcgtcggcttcacgtattac
agcgggaaccagtcttctcgatgctcctccacgaaaaccagtgacaaacacggcagcacc
acgaaagaagacaaaagccacctggagaacctgcagaagaggatccatcagctggaggag
cagctgcacggagaaatgcagctcaaagatgagatggagcagaagtgcagggcatccaac
atcaaactggataagatgatgaaagagctggatgaagagagtaatgcgaggaagagtgtg
gaggccagtctgtctctgctggagaaagataagctgatgctgcagcatcgagtcacggat
caccagaggaaagcggatcaggaggcggagaaacggaggaatctggagaacgaggtctcc
tctctaaaggaacagctggagaacctgaggaagatcagccagaacactcaggcctcaagt
gataagatcgcccagctgcagcaccagttggaggaggcgaatgacctgctgcgggcggag
tcggacacggcggcgcgtctgaggaagagtcagacggagatggggaaggccatgagtcag
ctggaggggctgaacggagagctgcaggagaaagcccgggcgtccgacagcgcccgacag
cagctggagagagaactgctccagctccagaacacgctggataccgagcgccgaacctgc
agccagggctctgaggagatacgccaactacaggctcgtatgatgggtctgcaggaggac
aataagaacctgaggctgagtttatctaaagtggaggcggagaggaagcaggcccaggag
aggagtaacagtctggagaaggagaagaacagtctggagattgatctgaactataagctg
aagattctgcagcagcgtctggatcaggagatcacggagcaccgggtcagccgagcacag
ctgaccgacaaatacgagtccatcgaggaggccaagtccgccgccatgcacgcggtggag
caaaaggtgtctgaggaaagcgtgctgaggctgcgggcggagagccgggtggtggaggtg
gagaagcagtgctccatgctggagtttgatctgaagcagtcggtgcagaagatggagcag
ctgatgaagcagaaggagaggctggaggacgaggtgaaggttctgcgggtgcagctggat
caggagtgcagtaaacgagccgtggctcagactgatctgaagacccggaccggcgaggtg
gagagactgaggggttctgagaagcagctgaagcaggaaatcaacaccaccctggagaac
aagcgatcactggagttccagctcgcacagctcaccaagcagtacagagggaatgaaggt
cagatgagggagctgcaggatcagctggaggcggagcagtatttctctacgctgtataaa
actcaggtgaaggaactgaaggaggagctggaggagaggaaccggctggtgcaggacgca
cagaaaaaagtgcaggagatgcacgcagaaagggattctctgatggcgcagctggatctg
accgtaacgaaggcggagtcggagcagatcttcagagagagactctaatatagcacggca
cgggtaaccatagcaacgcacacacttatacacacacttatacaggagatctcagagaga
gactccactatagcacggcttgaggattccaacaaaacccttaccaaagacgtggagacc
ctcagcagggagaaagccgagctggacgagaagctccgatctcaggaggacgaatattca
gcccagaaggaagaaatttccaactccatcaaggcaaattacgagaagatactgaacaca
gagcgaaccctgaagacccaggcggtgaataaactggctgagatcatgaacaggaaggac
atgaagctggacaggaagaaccggggcagcaccacggacctgaggaagaaggagaaggag
aaccgcaagctgcagctggagctcaaccaggagaaggagaagttcaaccacatggccatc
aaataccagaaggagctgaacgagatgcaggcggtgagagctggagcatcacagaccaat
cacacgagaatcaatcaatcaatcaatatcttatcatacactgtgtaa

DBGET integrated database retrieval system