KEGG   Astyanax mexicanus (Mexican tetra): 103041717Help
Entry
103041717         CDS       T05042                                 

Definition
(RefSeq) galactocerebrosidase-like
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00600  Sphingolipid metabolism
amex01100  Metabolic pathways
amex04142  Lysosome
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103041717
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103041717
Enzymes [BR:amex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     103041717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M
Motif
Other DBs
NCBI-GeneID: 103041717
NCBI-ProteinID: XP_022529003
Ensembl: ENSAMXG00000000578
Position
9
AA seq 673 aa AA seqDB search
MCVGGRVEMSAVSRLCTLLLISACFTLTSAEHYSIDDQAGLGRVFDGIGGLSGGGATSRL
LINYAEPYRTQILDYLFKPNFGASLHILKVEIGGDAQSTDGTEPSHMHYEDDENYFRGYE
WWLMTEAKKRNPNITLIGLPWAFPGWIGRGVNWPYDFPDVTVSYIVSWIIGAKQYHDLDI
DYVGIWNERNFDIKYIKLLRYTLDKAGLERVRIIASDNLWEPITLSVLGDEELREAVDVL
GAHYPGTTSVPAAVKMGKQLWASEDYSTFNDEVGGGCWARILNQNYVNGLMSATISWNLV
ASYYQNLPFGRDGLMTAQEPWSGNYVVESPIWTTAHTTQFSQPGWKYLQTVGHLTHGGSY
VALTDQKGNLTIVIETMTHDHSVCIRPPLPPYNVTAQTATFSLKGSFASLSELQLWNSKF
DFKTKKPVFFQKLAPIKVSNGSFTLDLDVDEVYTVTTIPTGLKGSYPEPPPSSPFPKTYK
DDFNVKNPSFSEAPDFADQTGVFEYFMNLTDPGPHVYTLRQVVTQRPITWVADADQTVSV
IGDYSWQNMTVSCDVFMEKENSGGVFVAARLDKGGGSVRNARGIFFWVLADGTYRVTSDL
SGLSVLAEGLSGTRANTWNTLTLTVKGNFVSGELNGYLLWKNTVDLVPKNGWAAIGTSSF
ELAQFDNFAVQAE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgttgggggaagagtagagatgagtgcagtgagcaggctgtgcactctgctgctg
atttcagcttgttttactctcacttcagcagaacactactctatagatgatcaggcggga
ttagggcgcgtgtttgacggaattggaggattaagtggcggaggggccacgtcccgtctg
ctcattaactatgctgaaccttaccggactcaaatactggactacctgtttaagcccaac
tttggagcctctttgcacatcctgaaagttgaaattggaggagatgcccagtcgacagat
ggaacagagccgtctcacatgcactatgaggatgatgagaattacttcaggggttatgag
tggtggctgatgaccgaggccaagaagaggaaccccaacatcaccctgatcggtttgcct
tgggcttttccaggatggattggacgtggggtgaattggccctatgactttcctgatgtt
actgtttcctatattgtgtcctggattatcggagcgaaacagtaccatgacctagacatt
gattatgttggaatatggaatgagaggaattttgacatcaaatatataaagctgctgaga
tacacgctggataaagccggcctggagagggtcagaatcatcgccagtgacaacctctgg
gagcccattaccctcagtgtgctgggggacgaggagctgcgggaggcggtggatgtgctg
ggggctcactacccaggaaccacttcagtacctgcagctgtgaagatggggaagcagctg
tgggcgtctgaagattacagcaccttcaacgatgaagtgggaggaggctgctgggctcgg
atcctcaaccagaactacgtcaacggcctgatgtctgccactatttcctggaacctggtt
gccagttattatcagaatctcccgtttggaagagatgggctgatgacggctcaggaaccg
tggagcggcaactatgttgtggagtctccaatatggacaactgcccacaccacacagttc
tctcagcctggctggaagtacctgcagactgtaggtcacctgacccacggcgggagctac
gttgctttgactgaccagaaggggaacctgaccatagtgattgaaactatgactcacgat
cactctgtgtgcatccgacctcctctgcctccctataacgtcacagcgcagacagccacg
ttcagtctgaagggatcttttgcgtcactcagtgagctgcagctgtggaattccaagttc
gatttcaagacgaagaagccggtcttcttccagaaactcgcgcccataaaggtgtctaat
ggctcttttacgctggacctggatgttgatgaagtttacacagtgaccaccattcccacg
ggtctgaaaggatcttatcccgagcctcctccatcctctcccttccctaaaacctataaa
gatgattttaacgtcaagaaccccagcttctcggaggctccagacttcgccgatcagacg
ggcgtgtttgagtacttcatgaacctgacggaccccggccctcatgtttacacgctgcgg
caggtggtcactcagcggccgatcacctgggtggcggatgcggatcagaccgtcagcgtg
attggggattatagctggcagaacatgacggtgtcgtgtgacgtgtttatggagaaggag
aacagcggaggtgtgtttgttgcagcgaggttggataaaggaggaggttctgtgaggaat
gccaggggaatcttcttctgggtgttggcagacggcacatacagagtcaccagtgatctc
agtgggctgagtgttctggctgagggactgtccggaaccagagccaacacctggaacaca
ctcacactgactgtgaagggtaattttgtctctggagagctgaacggttatctgctgtgg
aagaatacagtagatttggtgccaaaaaacggatgggcggcgatcggcacgagctcgttc
gagctggctcagtttgataactttgcagtacaggcagagtaa

DBGET integrated database retrieval system